7YMJ: Alpha1AAR-Nb6 complex

Cryo-EM structure of alpha1AAR-Nb6 complex bound to tamsulosin. Determined by electron microscopy at 3.35 Å resolution. Released 5 Jul 2023.

Method: Electron microscopy
Resolution: 3.35 Å
Organisms: Homo sapiens, Lama glama
Chains: 2
Atoms: 3,085
Mol. weight: 57.73 kDa
Ligands: JGX
Released: 5 Jul 2023

Explore 7YMJ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7YMJ contains 15 α-helices and 12 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 0 β-strands

Element	Residues	Length
α-helix	26-53	28
α-helix	62-78	17
α-helix	80-89	10
α-helix	98-129	32
α-helix	134-137	4
α-helix	140-158	19
α-helix	161-163	3
α-helix	182-192	11
α-helix	194-213	20
α-helix	221-297	37
α-helix	308-311	4
α-helix	314-321	8
α-helix	322-324	3
α-helix	325-328	4
α-helix	332-342	11

Chain D: 0 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	1
β-strand	12-13	2	2
β-strand	19-27	9	1
β-strand	32-39	8	3
β-strand	49-54	6	3
β-strand	60-61	2	3
β-strand	70-74	5	1
β-strand	79-85	7	1
β-strand	93-95	3	2
β-strand	96-102	7	3
β-strand	110-113	4	3
β-strand	117-120	4	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
alpha1A-adrenergic receptor	A	protein	362	Homo sapiens	P35348 (AlphaFold model), P41145 (AlphaFold model)
Nb6	D	protein	151	Lama glama

Sequence of entity 1 (A), FASTA

>7YMJ_1 alpha1A-adrenergic receptor (chains A)
MKTIIALSYIFCLVFADYKDDDDAMVFLSGQASDSSQCTQPPAPVQISKAILLGVILGGL
ILFGVLGNILVILSVACHRHLHSVTHYYIVNLAVADLLLTSTVLPFSAIFEVLGYWAFGR
VFCNIWAAVDVLCCTARIWGLCIISIDRYIGVSYPLRYPTIVTQRRGLMALLCVWALSLV
ISIGPLFGWRQPAPEDETICQINEEPGYVLFSALGSFYLPLAIILVMYTLMILRLKSVRL
LSGSREKDRNLRRITRLVLIVVGCFVLCWLPFFLVMPIGSFFPDFKPSETVFKIVFWLGY
LNSCINPIIYPCSSQEFKKAFQNVLRIQCLCRKQSSKHALGYTLHPPSQAVEGQHHHHHH
HH

Sequence of entity 2 (D), FASTA

>7YMJ_2 Nb6 (chains D)
MKYLLPTAAAGLLLLAAQPAMAMAQVQLQESGGGLVQAGESLRLSCAASGTIFRLYDMGW
YRRVSGNQRELVASITSGGSTKYGDSVKGRFTISRDNAKNTVYLQMSSLKPEDTAVYYCN
AEYRTGIWEELLDGWGQGTQVTVSSHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
JGX	Tamsulosin	C20 H28 N2 O5 S	1

Primary citation

Structural basis of alpha 1A -adrenergic receptor activation and recognition by an extracellular nanobody. Toyoda, Y., Zhu, A., Kong, F. et al. Nat Commun (2023) 14:3655-3655. DOI 10.1038/s41467-023-39310-x · PubMed

Other PDB entries of the same protein (UniProt P35348 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8THK 2.6 Å, Cryo-EM structure of A61603-bound alpha-1A-adrenergic receptor in complex with…
8HN1 2.9 Å, Cryo-EM structure of AdTx1-alpha1AAR-Nb6
7YM8 2.92 Å, Cryo-EM structure of Nb29-alpha1AAR-miniGsq complex bound to oxymetazoline
9M4Q 2.99 Å, CryoEM structure of the alpha1AAR complex with doxazosin
8THL 3.1 Å, Cryo-EM structure of epinephrine-bound alpha-1A-adrenergic receptor in complex with…
9M4T 3.19 Å, CryoEM structure of the alpha1AAR complex with silodosin
9IQV 3.3 Å, Cryo-EM structure of MT3-alpha1AAR
7YMH 3.52 Å, Cryo-EM structure of Nb29-alpha1AAR-miniGsq complex bound to noradrenaline

Browse structure collections

About this viewer

MolViewer shows 7YMJ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.