7YO9: PDB entry 7YO9

Crystal structure of fusion protein of human TP53INP2 LIR and human GABARAP. Determined by X-ray diffraction at 1.75 Å resolution. Released 2 Nov 2022.

Method: X-ray diffraction
Resolution: 1.75 Å
Organism: Homo sapiens
Chains: 1
Atoms: 1,169
Mol. weight: 15.61 kDa
Ligands: PO4, IPA
Released: 2 Nov 2022

Explore 7YO9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7YO9 contains 7 α-helices and 10 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	1
β-strand	10-14	5	1
α-helix	19-23	5
α-helix	26-39	14
β-strand	43-50	8	2
α-helix	57-59	3
β-strand	63-67	5	2
β-strand	71	1	3
α-helix	72-82	11
β-strand	92-94	3	2
β-strand	95	1	4
β-strand	98	1	4
α-helix	99-101	3
β-strand	105	1	3
α-helix	106-113	8
α-helix	119	1
β-strand	120-125	6	2

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Tumor protein p53-inducible nuclear protein 2,Gamma-aminobutyric acid receptor-associated protein	A	protein	131	Homo sapiens	O95166 (AlphaFold model), Q8IXH6 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7YO9_1 Tumor protein p53-inducible nuclear protein 2,Gamma-aminobutyric acid receptor-associated protein (chains A)
GPEEDEVDGWLIIDLMKSTYKEEHPFEKRRSEGEKIRKKYPDRVPVIVEKAPKARIGDLD
KKKYLVPSDLTVGQFYFLIRKRIHLRAEDALFFFVNNVIPPTSATMGQLYQEHHEEDFFL
YIAYSDESVYG

Ligands and cofactors

ID	Name	Formula	Copies
PO4	Phosphate ion	O4 P	1
IPA	Isopropyl alcohol	C3 H8 O	1

Primary citation

Development of new tools to study membrane-anchored mammalian Atg8 proteins. Park, S.W., Jeon, P., Yamasaki, A. et al. Autophagy (2023) 19:1424-1443. DOI 10.1080/15548627.2022.2132040 · PubMed

Other PDB entries of the same protein (UniProt O95166 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6HYO 1.07 Å, Structure of ULK1 LIR motif bound to GABARAP
6YOP 1.1 Å, Structure of SAMM50 LIR bound to GABARAP
7ZKR 1.1 Å, Human GABARAP in complex with stapled peptide Pen3-ortho
6HYN 1.14 Å, Structure of ATG13 LIR motif bound to GABARAP
7AA8 1.25 Å, Structure of SCOC LIR bound to GABARAP
6HOG 1.26 Å, Structure of VPS34 LIR motif bound to GABARAP
8T2M 1.27 Å, Crystal structure of GABARAP in complex with the LIR of NSs4
3D32 1.3 Å, Complex of GABA(A) receptor-associated protein (GABARAP) with a synthetic peptide
6HB9 1.3 Å, Crystal structure of the GABARAP in complex with the UBA5 LIR motif
7BRQ 1.4 Å, Crystal structure of human FAM134B LIR fused to human GABARAP
9I9X 1.42 Å, Human GABARAP in complex with artificial peptide IM-2
9HGD 1.5 Å, Crystal structure of human GABARAP in complex with cyclic peptide GAB_D23

Browse structure collections

About this viewer

MolViewer shows 7YO9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.