7YZB: Human FoxH1

Crystal structure of the human FoxH1 bound to the TGTGGATT site. Determined by X-ray diffraction at 1.47 Å resolution. Released 16 Nov 2022.

Method: X-ray diffraction
Resolution: 1.47 Å
Organism: Homo sapiens
Chains: 3
Atoms: 1,875
Mol. weight: 30.41 kDa
Released: 16 Nov 2022

Explore 7YZB in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7YZB contains 9 α-helices and 7 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	38-48	11
β-strand	54	1	1
α-helix	56-66	11
α-helix	77-87	11
β-strand	91-94	4	1
β-strand	97	1	2
β-strand	100	1	2
β-strand	107-110	4	1
α-helix	112-114	3
α-helix	117-120	4
β-strand	121	1	3
α-helix	122-123	2
α-helix	126-131	6
β-strand	143	1	3
α-helix	145-149	5
α-helix	152-154	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Forkhead box protein H1	A	protein	185	Homo sapiens	O75593 (AlphaFold model)
DNA (5'-d(apgpaptptpgptpgpgpaptptpgpcpgpa)-3')	B	DNA	16	Homo sapiens
DNA (5'-d(tpcpgpcpapaptpcpcpapcpapaptpcpt)-3')	C	DNA	16	Homo sapiens

Sequence of entity 1 (A), FASTA

>7YZB_1 Forkhead box protein H1 (chains A)
MGPSSGSRLGPPEAESPSQPPKRRKKRYLRHDKPPYTYLAMIALVIQAAPSRRLKLAQII
RQVQAVFPFFREDYEGWKDSIRHNLSSNRCFRKVPKDPAKPQAKGNFWAVDVSLIPAEAL
RLQNTALCRRWQNGGARGAFAKDLGPYVLHGRPYRPPSPPPPPSEGFSIKSLLGGSGEGA
PWPGL

Sequence of entity 2 (B), FASTA

>7YZB_2 DNA (5'-D(*AP*GP*AP*TP*TP*GP*TP*GP*GP*AP*TP*TP*GP*CP*GP*A)-3') (chains B)
AGATTGTGGATTGCGA

Sequence of entity 3 (C), FASTA

>7YZB_3 DNA (5'-D(*TP*CP*GP*CP*AP*AP*TP*CP*CP*AP*CP*AP*AP*TP*CP*T)-3') (chains C)
TCGCAATCCACAATCT

Primary citation

Molecular basis for DNA recognition by the maternal pioneer transcription factor FoxH1. Pluta, R., Aragon, E., Prescott, N.A. et al. Nat Commun (2022) 13:7279-7279. DOI 10.1038/s41467-022-34925-y · PubMed

Other PDB entries of the same protein (UniProt O75593 (AlphaFold model), which also has an AlphaFold model), best resolution first:

5XOC 2.4 Å, Crystal structure of human Smad3-FoxH1 complex

Browse structure collections

About this viewer

MolViewer shows 7YZB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.