5XOC: Human Smad3-FoxH1 complex

Crystal structure of human Smad3-FoxH1 complex. Determined by X-ray diffraction at 2.4 Å resolution. Released 28 Mar 2018.

Method: X-ray diffraction
Resolution: 2.4 Å
Organisms: Homo sapiens, Escherichia coli (strain K12)
Chains: 2
Atoms: 2,596
Mol. weight: 37.9 kDa
Released: 28 Mar 2018

Explore 5XOC in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

5XOC contains 16 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	222-224	3
β-strand	233-239	7	1
β-strand	242-243	2	1
β-strand	248-250	3	1
β-strand	254-258	5	2
β-strand	268-270	3	2
α-helix	281-287	7
β-strand	294-299	6	2
β-strand	302-307	6	2
β-strand	313-316	4	1
α-helix	318-323	6
β-strand	331-334	4	1
β-strand	339-344	6	2
α-helix	345-358	14
α-helix	360-364	5
α-helix	365-370	6
β-strand	371-376	6	1
α-helix	389-391	3
β-strand	395-400	6	1
α-helix	401-411	11

Chain B: 8 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	215-217	3	3
α-helix	223	1
α-helix	224-228	5
β-strand	233-239	7	3
α-helix	244-259	16
β-strand	265-270	6	3
α-helix	277-280	4
β-strand	288-293	6	3
β-strand	296-302	7	3
α-helix	307-317	11
α-helix	327-330	4
α-helix	334-336	3
β-strand	337-339	3	1
α-helix	340-343	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Mothers against decapentaplegic homolog 3	A	protein	199	Homo sapiens	P84022 (AlphaFold model)
Thioredoxin 1,Forkhead box protein H1	B	protein	141	Escherichia coli (strain K12), Homo sapiens	O75593 (AlphaFold model), P0AA25 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>5XOC_1 Mothers against decapentaplegic homolog 3 (chains A)
GPDLQPVTYCEPAFWCSISYYELNQRVGETFHASQPSMTVDGFTDPSNSERFCLGLLSNV
NRNAAVELTRRHIGRGVRLYYIGGEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPG
CNLKIFNNQEFAALLAQSVNQGFEAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIE
LHLNGPLQWLDKVLTQMGS

Sequence of entity 2 (B), FASTA

>5XOC_2 Thioredoxin 1,Forkhead box protein H1 (chains B)
MHHHHHHSDKIIHLTDDSFDTDVLKADGAILVDFWAEWCGPCKMIAPILDEIADEYQGKL
TVAKLNIDQNPGTAPKYGIRGIPTLLLFKNGEVAATKVGALSKGQLKEFLDANLAGSGLL
CDLDALFQGVPPNKSIYDVWV

Primary citation

Hydrophobic patches on SMAD2 and SMAD3 determine selective binding to cofactors. Miyazono, K.I., Moriwaki, S., Ito, T. et al. Sci Signal (2018) 11. DOI 10.1126/scisignal.aao7227 · PubMed

Other PDB entries of the same protein (UniProt P84022 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6YIB 1.7 Å, 14-3-3 sigma in complex with SMAD3 pS423 peptide
1MJS 1.91 Å, MH2 domain of transcriptional factor SMAD3
5OD6 2.0 Å, Crystal structure of Smad3-MH1 bound to the GGCGC site.
5ODG 2.12 Å, Crystal structure of Smad3-MH1 bound to the GGCT site.
6ZMN 2.33 Å, Crystal structure of the Smad3-Smad5 MH1 domain chimera bound to the GGCGC site
1OZJ 2.4 Å, Crystal structure of Smad3-MH1 bound to DNA at 2.4 A resolution
1U7F 2.6 Å, Crystal Structure of the phosphorylated Smad3/Smad4 heterotrimeric complex
1MK2 2.74 Å, SMAD3 SBD complex
1MHD 2.8 Å, Crystal structure of a smad MH1 domain bound to DNA
2LAJ Third WW domain of human Nedd4L in complex with doubly phosphorylated human smad3…
2LB2 Structure of the second domain of human Nedd4L in complex with a phosphorylated pTPY…

Browse structure collections

About this viewer

MolViewer shows 5XOC directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.