7Z8Y: SUN1-KASH6 9:6 complex

Crystal structure of the SUN1-KASH6 9:6 complex. Determined by X-ray diffraction at 2.29 Å resolution. Released 27 Sept 2023.

Method: X-ray diffraction
Resolution: 2.29 Å
Organism: Homo sapiens
Chains: 5
Atoms: 5,192
Mol. weight: 74.27 kDa
Released: 27 Sept 2023

Explore 7Z8Y in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7Z8Y contains 26 α-helices and 38 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	619-634	16
β-strand	651-652	2	1
α-helix	654-656	3
α-helix	658-659	2
β-strand	660	1	2
α-helix	661	1
β-strand	666-670	5	3
β-strand	673-678	6	3
α-helix	682-686	5
β-strand	696-699	4	2
β-strand	703-721	19	1
α-helix	725-727	3
β-strand	737-745	9	1
β-strand	754-760	7	1
β-strand	768-772	5	1
α-helix	773-775	3
β-strand	782-792	11	1
β-strand	798-801	4	2
β-strand	803-810	8	1

Chain B: 6 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	619-634	16
β-strand	651-652	2	4
α-helix	654-656	3
α-helix	658-659	2
β-strand	660	1	5
β-strand	666-670	5	6
β-strand	673-677	5	6
α-helix	682-686	5
β-strand	696-699	4	5
β-strand	703-721	19	4
α-helix	725-727	3
β-strand	737-745	9	4
β-strand	754-760	7	4
β-strand	768-772	5	4
α-helix	773-775	3
β-strand	782-792	11	4
β-strand	798-801	4	5
β-strand	803-810	8	4

Chain C: 8 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	619-634	16
β-strand	651-652	2	7
α-helix	654-656	3
α-helix	658-659	2
β-strand	660	1	8
α-helix	661	1
β-strand	668-670	3	9
β-strand	673-675	3	9
α-helix	682-686	5
β-strand	696-699	4	8
β-strand	703-721	19	7
α-helix	725-727	3
β-strand	737-745	9	7
α-helix	753	1
β-strand	754-760	7	7
β-strand	768-772	5	7
α-helix	773-775	3
β-strand	782-792	11	7
β-strand	798-801	4	8
β-strand	803-810	8	7

Chain D: 3 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	530-541	12
α-helix	542-544	3
β-strand	546-549	4	6
α-helix	552-554	3

Chain E: 2 helices, 1 β-strand

Element	Residues	Length	Sheet
β-strand	544-546	3	9
α-helix	547-548	2
α-helix	552-554	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
SUN domain-containing protein 1	A, B, C	protein	203	Homo sapiens	O94901 (AlphaFold model)
Inositol 1,4,5-triphosphate receptor associated 2	D, E	protein	28	Homo sapiens	Q12912 (AlphaFold model)

Sequence of entity 1 (A, B, C), FASTA

>7Z8Y_1 SUN domain-containing protein 1 (chains A, B, C)
GSGGSGGITEAQARAIVNSALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTALMS
LFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMMIHPAAFTLEHIPKTLSP
TGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGESLQMFQALKRPDDTAFQIVELRI
FSNWGHPEYTCLYRFRVHGEPVK

Sequence of entity 2 (D, E), FASTA

>7Z8Y_2 Inositol 1,4,5-triphosphate receptor associated 2 (chains D, E)
GSMEDSWTSLEHILWPFTRLRHNGPPPV

Primary citation

The crystal structure of SUN1-KASH6 reveals an asymmetric LINC complex architecture compatible with nuclear membrane insertion. Gurusaran, M., Erlandsen, B.S., Davies, O.R. Commun Biol (2024) 7:138-138. DOI 10.1038/s42003-024-05794-6 · PubMed

Other PDB entries of the same protein (UniProt O94901 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6R2I 1.54 Å, Crystal structure of the SUN1-KASH5 6:6 complex
8B46 1.67 Å, Crystal structure of the SUN1-KASH6 9:9 complex
6R15 1.82 Å, Crystal structure of the SUN1-KASH1 6:6 complex
8B5X 1.98 Å, Crystal structure of the SUN1-KASH6 9:6 complex
8AU0 2.07 Å, Crystal structure of the a1 luminal coiled-coil domain of SUN1
6R16 2.75 Å, Crystal structure of the SUN1-KASH4 6:6 complex
7E34 3.19 Å, Crystal structure of SUN1-Speedy A-CDK2

Browse structure collections

About this viewer

MolViewer shows 7Z8Y directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.