7ZAW: Glypican-3

GPC3-Unc5D octamer structure and role in cell migration. Determined by X-ray diffraction at 2.58 Å resolution. Released 2 Nov 2022.

Method: X-ray diffraction
Resolution: 2.58 Å
Organism: Homo sapiens
Chains: 1
Atoms: 2,864
Mol. weight: 53.83 kDa
Ligands: NAG
Released: 2 Nov 2022

Explore 7ZAW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ZAW contains 18 α-helices and 5 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 18 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	75-133	59
α-helix	135-137	3
α-helix	140-156	17
α-helix	163-177	15
α-helix	178-183	6
α-helix	195-204	10
α-helix	211-243	33
α-helix	250-260	11
α-helix	262-265	4
β-strand	273	1	1
β-strand	274	1	2
α-helix	275-285	11
α-helix	287-290	4
α-helix	292-309	18
α-helix	316-321	6
α-helix	323-335	13
α-helix	338-348	11
α-helix	384-396	13
α-helix	405-411	7
β-strand	416	1	2
β-strand	420-423	4	1
β-strand	428-431	4	1
α-helix	457-474	18

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glypican-3	A	protein	464	Homo sapiens	P51654 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7ZAW_1 Glypican-3 (chains A)
ETGDATCHQVRSFFQRLQPGLKWVPETPVPGSDLQVCLPKGPTCCSRKMEEKYQLTARLN
MEQLLQSASMELKFLIIQNAAVFQEAFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEF
FTDVSLYILGSDINVDDMVNELFDSLFPVIYTQLMNPGLPDSALDINECLRGARRDLKVF
GNFPKLIMTQVSKSLQVTRIFLQALNLGIEVINTTDHLKFSKDCGRMLTRMWYCSYCQGL
MMVKPCGGYCNVVMQGCMAGVVEIDKYWREYILSLEELVNGMYRIYDMENVLLGLFSTIH
DSIQYVQKNAGKLTTTIGKLCAHSQQRQYRFAYYPEDLFIDKKVLKVAHVEHEETLSSRR
RELIQKLKSFISFYSALPGYICSHSPVAENDTLCWNGQELVERYSQKAARNGMKNQFNLH
ELKMKGPEPVVSQIIDKLKHINQLLRTMSMPKGRVGTKHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

GPC3-Unc5 receptor complex structure and role in cell migration. Akkermans, O., Delloye-Bourgeois, C., Peregrina, C. et al. Cell (2022) 185:3931-3949.e26. DOI 10.1016/j.cell.2022.09.025 · PubMed

Other PDB entries of the same protein (UniProt P51654 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9NTQ 4.04 Å, Identification and non-clinical characterization of SAR444200, a novel anti-GPC3 T-cell…
7ZA1 4.1 Å, GPC3-Unc5D octamer structure and role in cell migration
9NTT 7.45 Å, Identification and non-clinical characterization of SAR444200, a novel anti-GPC3 T-cell…

Browse structure collections

About this viewer

MolViewer shows 7ZAW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.