9NTT: Glypican-3

Identification and non-clinical characterization of SAR444200, a novel anti-GPC3 T-cell engager for the treatment of GPC3+ solid tumors. Determined by electron microscopy at 7.45 Å resolution. Released 14 Jan 2026.

Method: Electron microscopy
Resolution: 7.45 Å
Organisms: Homo sapiens, Lama glama
Chains: 2
Atoms: 3,719
Mol. weight: 54.74 kDa
Ligands: NAG
Released: 14 Jan 2026

Explore 9NTT in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

9NTT contains 24 α-helices and 17 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 5 β-strands

Element	Residues	Length	Sheet
α-helix	75-113	39
α-helix	116-133	18
α-helix	135-137	3
α-helix	140-156	17
α-helix	163-177	15
α-helix	178-183	6
α-helix	195-204	10
α-helix	212-225	14
α-helix	229-238	10
α-helix	243-245	3
α-helix	250-260	11
α-helix	262-265	4
β-strand	273	1	1
β-strand	274	1	2
α-helix	275-285	11
α-helix	287-290	4
α-helix	292-309	18
α-helix	316-321	6
α-helix	323-335	13
α-helix	338-348	11
α-helix	384-396	13
α-helix	405-411	7
β-strand	416	1	2
β-strand	420-423	4	1
β-strand	428-431	4	1
α-helix	458-465	8
α-helix	469-474	6

Chain B: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	3
β-strand	11-13	3	4
β-strand	20-26	7	3
β-strand	38-44	7	4
β-strand	51-56	6	4
β-strand	65-67	3	4
α-helix	69-71	3
β-strand	72	1	3
β-strand	76-81	6	3
β-strand	86-91	6	3
α-helix	96-98	3
β-strand	100-109	10	4
β-strand	113-118	6	4
β-strand	122-126	5	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glypican-3	A	protein	355	Homo sapiens	P51654 (AlphaFold model)
A0226018C08	B	protein	127	Lama glama

Sequence of entity 1 (A), FASTA

>9NTT_1 Glypican-3 (chains A)
CHQVRGSDLQVCLPKGPTCCSRKMEEKYQLTARLNMEQLLQSASMELKFLIIQNAAVFQE
AFEIVVRHAKNYTNAMFKNNYPSLTPQAFEFVGEFFTDVSLYILGSDINVDDMVNELFDS
LFPVIYTQLMNPGLDINECLRGARRDLKVFGFPKLIMTQVSKSLQVTIFLQALNLGIEVN
TTDHLKSKDCGRMLTRMWYCSYCQGLMMVKPCGGYCNVVMQGCMAGVVEIDKYWREYILS
LEELVNGMDMENVLLGLFSTIHDSIQYVQKNAGKLTTTIGKLCTLSSRRRELIQKLKSFI
SFYSALPGYICSHSPVAENDTLCWNGQELVERYSQPVVSQIIDKLHINQLLRTMS

Sequence of entity 2 (B), FASTA

>9NTT_2 A0226018C08 (chains B)
EVQLVESGGGLVQPGLRLSCVASGFTFSSFAMTWVRRPPGKGLEWVATITNGGVTSYRDS
VKGRFTISRDNAKNTLYLEMTSLNPEDTAVYICANARRTGPRAPTDIGSYRGQGTLVTVS
SHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Identification and Nonclinical Characterization of SAR444200, a Novel Anti-GPC3 NANOBODY T-cell Engager, for the Treatment of GPC3+ Solid Tumors. Meoni, P., Vintem, A.P.B., Cortez-Retamozo, V.F. et al. Mol Cancer Ther (2026) 25:361-370. DOI 10.1158/1535-7163.MCT-24-1049 · PubMed

Other PDB entries of the same protein (UniProt P51654 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7ZAW 2.58 Å, GPC3-Unc5D octamer structure and role in cell migration
9NTQ 4.04 Å, Identification and non-clinical characterization of SAR444200, a novel anti-GPC3 T-cell…
7ZA1 4.1 Å, GPC3-Unc5D octamer structure and role in cell migration

Browse structure collections

About this viewer

MolViewer shows 9NTT directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.