7ZG0: Murine IL-27

Murine IL-27 in complex with IL-27Ra and a non-competing Nb. Determined by X-ray diffraction at 3.18 Å resolution. Released 2 Nov 2022.

Method: X-ray diffraction
Resolution: 3.18 Å
Organisms: Mus musculus, Lama glama
Chains: 8
Atoms: 10,641
Mol. weight: 195.87 kDa
Ligands: NAG
Released: 2 Nov 2022

Explore 7ZG0 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ZG0 contains 47 α-helices and 90 β-strands across 8 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	36-68	33
α-helix	74-76	3
β-strand	88-89	2	1
α-helix	90-95	6
α-helix	98-109	12
α-helix	112-119	8
α-helix	120-122	3
α-helix	127-154	28
α-helix	195-222	28

Chain B: 9 helices, 1 β-strand

Element	Residues	Length	Sheet
α-helix	36-68	33
α-helix	74-76	3
α-helix	78-79	2
β-strand	88-89	2	2
α-helix	90-95	6
α-helix	98-109	12
α-helix	112-119	8
α-helix	120-122	3
α-helix	127-154	28
α-helix	195-222	28

Chains C and D: 6 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	32-38	7	3
β-strand	42-47	6	3
β-strand	60-67	8	4
α-helix	74-75	2
β-strand	76-77	2	4
β-strand	79	1	3
β-strand	87-91	5	3
α-helix	93	1
β-strand	94-95	2	2
α-helix	100	1
β-strand	101-109	9	4
β-strand	112-120	9	4
α-helix	122-125	4
α-helix	128-131	4
β-strand	132-139	8	5
β-strand	142-148	7	5
β-strand	161-169	9	6
β-strand	176-181	6	6
β-strand	185-189	5	5
β-strand	197-205	9	6
α-helix	212-219	8
β-strand	220	1	5

Chain E: 7 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	34-39	6	11
β-strand	44-49	6	11
β-strand	60-65	6	12
β-strand	73-77	5	12
α-helix	78-79	2
β-strand	84-87	4	11
α-helix	89-91	3
β-strand	97-104	8	12
β-strand	107-108	2	12
β-strand	113-116	4	12
β-strand	121	1	11
α-helix	125-126	2
β-strand	127-135	9	13
β-strand	141-147	7	13
β-strand	157-165	9	14
α-helix	171	1
β-strand	172-179	8	14
α-helix	184-185	2
β-strand	186-188	3	13
α-helix	191-192	2
β-strand	196-205	10	14
α-helix	211-217	7
β-strand	218-221	4	14

Chain F: 7 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	34-39	6	15
β-strand	44-49	6	15
β-strand	60-65	6	16
β-strand	73-77	5	16
α-helix	78-79	2
β-strand	84-87	4	15
α-helix	89-91	3
β-strand	97-104	8	16
β-strand	107-108	2	16
β-strand	113-116	4	16
β-strand	121	1	15
α-helix	125-126	2
β-strand	127-135	9	17
β-strand	141-147	7	17
β-strand	157-165	9	18
α-helix	170-171	2
β-strand	172-179	8	18
α-helix	184-185	2
β-strand	186-188	3	17
α-helix	191-192	2
β-strand	196-205	10	18
α-helix	211-217	7
β-strand	218-221	4	18

Chains G and H: 2 helices, 12 β-strands

Element	Residues	Length	Sheet
β-strand	2-7	6	19
β-strand	10-11	2	20
β-strand	18-26	9	19
β-strand	40-48	9	20
α-helix	53-54	2
β-strand	55-61	7	20
β-strand	66-68	3	20
β-strand	73	1	19
β-strand	76-79	4	19
β-strand	86-91	6	19
α-helix	96-98	3
β-strand	100-110	11	20
β-strand	113-118	6	20
β-strand	122-125	4	20

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-27 subunit alpha	A, B	protein	246	Mus musculus	Q8K3I6 (AlphaFold model)
Interleukin-27 subunit beta	C, D	protein	241	Mus musculus	O35228 (AlphaFold model)
Interleukin-27 receptor subunit alpha	E, F	protein	219	Mus musculus	O70394 (AlphaFold model)
Nanobody 5	G, H	protein	166	Lama glama

Sequence of entity 1 (A, B), FASTA

>7ZG0_1 Interleukin-27 subunit alpha (chains A, B)
MGILPSPGMPALLSLVSLLSVLLMGCVAETGFPTDPLSLQELRREFTVSLYLARKLLSEV
QGYVHSFAESRLPGVNLDLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLG
GLGTQGTWTSSEREQLWAMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKK
LPLGALGGPNQVSSQVSWPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDSGTK
HHHHHH

Sequence of entity 2 (C, D), FASTA

>7ZG0_2 Interleukin-27 subunit beta (chains C, D)
MGILPSPGMPALLSLVSLLSVLLMGCVAETGYTETALVALSQPRVQCHASRYPVAVDCSW
TPLQAPNSTRSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTA
VHPGGASSSLLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRY
RRRGASHFRQVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHK
P

Sequence of entity 3 (E, F), FASTA

>7ZG0_3 Interleukin-27 receptor subunit alpha (chains E, F)
EHHHHHHHHENLYFQGTGTRPHGSPGPLQCYSVGPLGILNCSWEPLGDLETPPVLYHQSQ
KYHPNRVWEVKVPSKQSWVTIPREQFTMADKLLIWGTQKGRPLWSSVSVNLETQMKPDTP
QIFSQVDISEEATLEATVQWAPPVWPPQKVLICQFRYKECQAETWTRLEPQLKTDGLTPV
EMQNLEPGTCYQVSGRCQVENGYPWGEWSSPLSFQTPFL

Sequence of entity 4 (G, H), FASTA

>7ZG0_4 Nanobody 5 (chains G, H)
MGKYLLPTAAAGLLLLAAQPAMAHHHHHHSSGDEVDTGQVQLQESGGGLVQPGGSLRLSC
AASGSVFSDNAMGWSPNINAMGWFRQAPGKQPDMVADISNTGSIDYADSVKGRFTISRDN
GKNTVTLQMNSLKPEDTAVYVCSADIRVGLRDYDYWGQGTQVTVSS

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4

Primary citation

Structural basis of activation and antagonism of receptor signaling mediated by interleukin-27. Skladanowska, K., Bloch, Y., Strand, J. et al. Cell Rep (2022) 41:111490-111490. DOI 10.1016/j.celrep.2022.111490 · PubMed

Other PDB entries of the same protein (UniProt Q8K3I6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Z0L 4.0 Å, IL-27 signalling complex

Browse structure collections

About this viewer

MolViewer shows 7ZG0 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.