7Z0L: IL-27 signalling complex

IL-27 signalling complex. Determined by electron microscopy at 4.0 Å resolution. Released 27 Jul 2022.

Method: Electron microscopy
Resolution: 4.0 Å
Organism: Mus musculus
Chains: 3
Atoms: 7,039
Mol. weight: 113.92 kDa
Ligands: NAG
Released: 27 Jul 2022

Explore 7Z0L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7Z0L contains 39 α-helices and 60 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 15 helices, 27 β-strands

Element	Residues	Length	Sheet
β-strand	29-32	4	1
β-strand	37-39	3	2
β-strand	44-50	7	1
α-helix	52-58	7
α-helix	62-64	3
β-strand	65-69	5	2
β-strand	72-73	2	2
α-helix	74-75	2
α-helix	76-78	3
β-strand	79-83	5	1
β-strand	86-91	6	1
β-strand	98-106	9	2
α-helix	108-110	3
β-strand	112-123	12	2
α-helix	125-129	5
β-strand	130-135	6	3
β-strand	136-137	2	4
β-strand	143-147	5	3
β-strand	156-164	9	5
β-strand	167-168	2	5
α-helix	169-171	3
β-strand	172-174	3	5
β-strand	179-181	3	3
α-helix	185-186	2
β-strand	192-200	9	5
β-strand	203-206	4	5
α-helix	207-209	3
β-strand	210-212	3	5
α-helix	214-217	4
β-strand	218-219	2	4
α-helix	220-223	4
β-strand	224-230	7	6
β-strand	238-243	6	6
α-helix	246-249	4
β-strand	253-261	9	7
β-strand	268-269	2	7
α-helix	272-275	4
β-strand	281-284	4	6
α-helix	287-288	2
β-strand	292-301	10	7
α-helix	308-314	7
β-strand	315-318	4	7

Chain B: 16 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	31-35	5	8
β-strand	42-48	7	8
α-helix	49-50	2
α-helix	57-59	3
β-strand	60-67	8	9
α-helix	74-75	2
β-strand	76-77	2	9
β-strand	80	1	8
β-strand	87-91	5	8
β-strand	101-108	8	9
β-strand	113-120	8	9
α-helix	128-131	4
β-strand	132-139	8	10
β-strand	142-148	7	10
β-strand	161-169	9	11
β-strand	176-181	6	11
β-strand	185	1	10
β-strand	197-205	9	11
β-strand	212	1	11
α-helix	213-219	7
β-strand	220-221	2	10
α-helix	255-257	3
α-helix	258-289	32
α-helix	306-307	2
α-helix	312-317	6
α-helix	320-331	12
α-helix	334-343	10
α-helix	349-376	28
α-helix	383-385	3
α-helix	386-398	13
α-helix	418-445	28
α-helix	447-449	3

Chain C: 8 helices, 17 β-strands

Element	Residues	Length	Sheet
α-helix	32-34	3
β-strand	35-38	4	12
β-strand	45-48	4	12
α-helix	50-52	3
β-strand	60-65	6	13
β-strand	74-77	4	13
α-helix	78-79	2
β-strand	84-87	4	12
β-strand	97-104	8	13
β-strand	107-108	2	13
β-strand	113-116	4	13
β-strand	121	1	12
α-helix	123-126	4
β-strand	127-135	9	14
β-strand	140-147	8	14
α-helix	148-149	2
β-strand	157-165	9	15
β-strand	172-179	8	15
β-strand	182	1	15
α-helix	184-185	2
β-strand	186-191	6	14
α-helix	192	1
β-strand	196-205	10	15
α-helix	210-215	6
β-strand	218-221	4	15

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Interleukin-6 receptor subunit beta	A	protein	292	Mus musculus	Q00560 (AlphaFold model)
Interleukin-27 subunit beta,Interleukin-27 subunit alpha	B	protein	471	Mus musculus	O35228 (AlphaFold model), Q8K3I6 (AlphaFold model)
Interleukin-27 receptor subunit alpha	C	protein	230	Mus musculus	O70394 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7Z0L_1 Interleukin-6 receptor subunit beta (chains A)
CGYIYPEFPVVQRGSNFTAICVLKEACLQHYYVNASYIVWKTNHAAVPREQVTVINRTTS
SVTFTDVVLPSVQLTCNILSFGQIEQNVYGVTMLSGFPPDKPTNLTCIVNEGKNMLCQWD
PGRETYLETNYTLKSEWATEKFPDCQSKHGTSCMVSYMPTYYVNIEVWVEAENALGKVSS
ESINFDPVDKVKPTPPYNLSVTNSEELSSILKLSWVSSGLGGLLDLKSDIQYRTKDASTW
IQVPLEDTMSPRTSFTVQDLKPFTEYVFRIRSIKDSGKGYWSDWSEEASGTT

Sequence of entity 2 (B), FASTA

>7Z0L_2 Interleukin-27 subunit beta,Interleukin-27 subunit alpha (chains B)
MVSAIVLYVLLAAAAHSAFAGSYTETALVALSQPRVQCHASRYPVAVDCSWTPLQAPNST
RSTSFIATYRLGVATQQQSQPCLQRSPQASRCTIPDVHLFSTVPYMLNVTAVHPGGASSS
LLAFVAERIIKPDPPEGVRLRTAGQRLQVLWHPPASWPFPDIFSLKYRLRYRRRGASHFR
QVGPIEATTFTLRNSKPHAKYCIQVSAQDLTDYGKPSDWSLPGQVESAPHKPRGGGGSGG
GGSVESGENLYFQGFPTDPLSLQELRREFTVSLYLARKLLSEVQGYVHSFAESRLPGVNL
DLLPLGYHLPNVSLTFQAWHHLSDSERLCFLATTLRPFPAMLGGLGTQGTWTSSEREQLW
AMRLDLRDLHRHLRFQVLAAGFKCSKEEEDKEEEEEEEEEEKKLPLGALGGPNQVSSQVS
WPQLLYTYQLLHSLELVLSRAVRDLLLLSLPRRPGSAWDSAAAHHHHHHHH

Sequence of entity 3 (C), FASTA

>7Z0L_3 Interleukin-27 receptor subunit alpha (chains C)
MVSAIVLYVLLAAAAHSAFAGSHGSPGPLQCYSVGPLGILNCSWEPLGDLETPPVLYHQS
QKYHPNRVWEVKVPSKQSWVTIPREQFTMADKLLIWGTQKGRPLWSSVSVNLETQMKPDT
PQIFSQVDISEEATLEATVQWAPPVWPPQKVLICQFRYKECQAETWTRLEPQLKTDGLTP
VEMQNLEPGTCYQVSGRCQVENGYPWGEWSSPLSFQTPFAAAHHHHHHHH

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	2

Primary citation

Structural insights into the assembly and activation of the IL-27 signaling complex. Jin, Y., Fyfe, P.K., Gardner, S. et al. EMBO Rep (2022) 23:e55450-e55450. DOI 10.15252/embr.202255450 · PubMed

Other PDB entries of the same protein (UniProt Q00560 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2HMH 2.0 Å, Crystal structure of SOCS3 in complex with gp130(pTyr757) phosphopeptide.
8QY4 3.06 Å, Structure of interleukin 11 (gp130 P496L mutant).
8QY5 3.1 Å, Structure of interleukin 6.
6C5X 3.1 Å, Crystal Structure of SOCS1 in complex with ElonginB and ElonginC
8QY6 3.16 Å, Structure of interleukin 6 (gp130 P496L mutant).
8V2C 3.46 Å, Cryo-EM structure of mouse type II OSM receptor complex: model for assembly core region
8V2B 3.67 Å, Cryo-EM structure of mouse type II OSM receptor complex: model for full extracellular…
4GL9 3.9 Å, Crystal structure of inhibitory protein SOCS3 in complex with JAK2 kinase domain and…
2BBU solution structure of mouse socs3 in complex with a phosphopeptide from the gp130 receptor

Browse structure collections

About this viewer

MolViewer shows 7Z0L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.