7ZKU: Human STING

Crystal structure of human STING in complex with 3',3'-c-(2'F,2'dAMP-2'd<carba>GMP). Determined by X-ray diffraction at 1.7 Å resolution. Released 25 Oct 2023.

Method: X-ray diffraction
Resolution: 1.7 Å
Organism: Homo sapiens
Chains: 2
Atoms: 3,350
Mol. weight: 47.04 kDa
Ligands: JLU
Released: 25 Oct 2023

Explore 7ZKU in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ZKU contains 21 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 11 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	155-163	9
α-helix	164-168	5
α-helix	169-185	17
α-helix	193-196	4
β-strand	198-203	6	1
α-helix	212-215	4
β-strand	219-224	6	1
α-helix	225-227	3
β-strand	228-232	5	2
β-strand	235-240	6	2
β-strand	243-249	7	1
β-strand	252-261	10	1
α-helix	264-271	8
α-helix	275-277	3
α-helix	281-300	20
α-helix	304-306	3
β-strand	309-314	6	1
α-helix	325-340	16

Chain B: 10 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	155-163	9
α-helix	164-168	5
α-helix	169-185	17
α-helix	193-196	4
β-strand	198-203	6	3
α-helix	212-215	4
β-strand	219-224	6	3
α-helix	225-227	3
β-strand	228-232	5	4
β-strand	235-240	6	4
β-strand	243-249	7	3
β-strand	252-261	10	3
α-helix	263-273	11
α-helix	281-300	20
α-helix	306-308	3
β-strand	309-314	6	3
α-helix	325-338	14

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Stimulator of interferon protein	A, B	protein	204	Homo sapiens	Q86WV6 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>7ZKU_1 Stimulator of interferon protein (chains A, B)
APAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRLY
ILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGTCVL
EYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPAD
DSSFSLSQEVLRHLRQEEKEEVTV

Ligands and cofactors

ID	Name	Formula	Copies
JLU	9-[(1~{S},6~{R},8~{R},9~{R},10~{R},15~{R},17~{R})-8-(6-aminopurin-9-yl)-9-fluor…	C21 H25 F N10 O10 P2	1

Primary citation

Crystal structure of human STING in complex with 3',3'-c-(2'F,2'dAMP-2'd<carba>GMP). Klima, M., Smola, M., Boura, E. To be published.

Other PDB entries of the same protein (UniProt Q86WV6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MX3 1.36 Å, Crystal structure of human STING (G230A, H232R, R293Q) in complex with Compound 1
4EMT 1.5 Å, Crystal Structure of human STING bound to c-di-GMP
6UKZ 1.52 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound 6
9CUD 1.53 Å, Human STING G230A/R293Q variant bound to diABZI-i
6UKU 1.68 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound 3
8STI 1.72 Å, human STING with agonist XMT-1616
6MX0 1.73 Å, Crystal structure of human STING apoprotein (G230A, H232R, R293Q)
6UKM 1.74 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound MSA-2
9VZG 1.74 Å, Harnessing Noncovalent Dimerization Enables an Orally Active STING Agonist for…
6UL0 1.76 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound 4
6XNP 1.77 Å, Crystal Structure of Human STING CTD complex with SR-717
7KW1 1.8 Å, Structure of hSTING in complex with novel carbocyclic pyrimidine CDN-3

Browse structure collections

About this viewer

MolViewer shows 7ZKU directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.