Crystal structure of SOCS2:ElonginB:ElonginC in complex with compound 9. Determined by X-ray diffraction at 1.94 Å resolution. Released 26 Apr 2023.
Explore 7ZLP in 3D Show helices and sheets RCSB PDB PDBe
7ZLP contains 22 α-helices and 23 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 31-46 | 16 | |
| β-strand | 49 | 1 | 1 |
| α-helix | 55-62 | 8 | |
| α-helix | 66 | 1 | |
| β-strand | 70-74 | 5 | 1 |
| β-strand | 82-88 | 7 | 1 |
| β-strand | 91-100 | 10 | 1 |
| β-strand | 103-106 | 4 | 1 |
| α-helix | 113-115 | 3 | |
| β-strand | 119 | 1 | 1 |
| α-helix | 122-134 | 13 | |
| α-helix | 142-143 | 2 | |
| β-strand | 155 | 1 | 1 |
| α-helix | 160-162 | 3 | |
| α-helix | 163-174 | 12 | |
| α-helix | 178-180 | 3 | |
| α-helix | 185-193 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-9 | 8 | 2 |
| β-strand | 10 | 1 | 3 |
| β-strand | 12-19 | 8 | 2 |
| β-strand | 23 | 1 | 4 |
| α-helix | 24-35 | 12 | |
| α-helix | 39-41 | 3 | |
| β-strand | 42-46 | 5 | 2 |
| β-strand | 49-50 | 2 | 2 |
| α-helix | 51-52 | 2 | |
| β-strand | 56 | 1 | 4 |
| β-strand | 68 | 1 | 5 |
| β-strand | 71 | 1 | 5 |
| α-helix | 72 | 1 | |
| β-strand | 73-79 | 7 | 2 |
| β-strand | 80-81 | 2 | 6 |
| β-strand | 84-85 | 2 | 6 |
| α-helix | 86-88 | 3 | |
| β-strand | 90 | 1 | 3 |
| α-helix | 91-100 | 10 | |
| α-helix | 101-103 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 18-22 | 5 | 2 |
| β-strand | 28-32 | 5 | 2 |
| α-helix | 33-36 | 4 | |
| α-helix | 40-46 | 7 | |
| β-strand | 59-61 | 3 | 2 |
| α-helix | 67-82 | 16 | |
| α-helix | 89-92 | 4 | |
| α-helix | 97-110 | 14 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Suppressor of cytokine signaling 2 | A | protein | 169 | Homo sapiens | O14508 (AlphaFold model) |
| Elongin-B | B | protein | 118 | Homo sapiens | Q15370 (AlphaFold model) |
| Elongin-C | C | protein | 97 | Homo sapiens | Q15369 (AlphaFold model) |
>7ZLP_1 Suppressor of cytokine signaling 2 (chains A) SMQAARLAKALRELGQTGWYWGSMTVNEAKEKLKEAPEGTFLIRDSSHSDYLLTISVKTS AGPTNLRIEYQDGKFRLDSIICVKSKLKQFDSVVHLIDYYVQMCKDKRTGPEAPRNGTVH LYLTKPLYTSAPSLQHLCRLTINKCTGAIWGLPLPTRLKDYLEEYKFQV
>7ZLP_2 Elongin-B (chains B) MDVFLMIRRHKTTIFTDAKESSTVFELKRIVEGILKRPPDEQRLYKDDQLLDDGKTLGEC GFTSQTARPQAPATVGLAFRADDTFEALCIEPFSSPPELPDVMKPQDSGSSANEQAVQ
>7ZLP_3 Elongin-C (chains C) MMYVKLISSDGHEFIVKREHALTSGTIKAMLSGPGQFAENETNEVNFREIPSHVLSKVCM YFTYKVRYTNSSTEIPEFPIAPEIALELLMAANFLDC
| ID | Name | Formula | Copies |
|---|---|---|---|
| JHR | [4-[(2~{S})-2-[2-(4-fluorophenyl)ethanoylamino]-3-[(4-fluorophenyl)methylamino]… | C24 H23 F2 N2 O6 P | 1 |
| PO4 | Phosphate ion | O4 P | 1 |
Structure-based design of a phosphotyrosine-masked covalent ligand targeting the E3 ligase SOCS2. Ramachandran, S., Makukhin, N., Haubrich, K. et al. Nat Commun (2023) 14:6345-6345. DOI 10.1038/s41467-023-41894-3 · PubMed
Other PDB entries of the same protein (UniProt O14508 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7ZLP directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.