7ZR2: Chimeric protein mimic of SARS-CoV-2 Spike HR1

Crystal structure of a chimeric protein mimic of SARS-CoV-2 Spike HR1 in complex with HR2. Determined by X-ray diffraction at 1.45 Å resolution. Released 9 Nov 2022.

Method: X-ray diffraction
Resolution: 1.45 Å
Organism: Severe acute respiratory syndrome coronavirus 2
Chains: 2
Atoms: 2,330
Mol. weight: 31.25 kDa
Released: 9 Nov 2022

Explore 7ZR2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ZR2 contains 9 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	2-73	72
α-helix	77-144	68
α-helix	145-148	4
α-helix	156-224	69

Chain B: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	1169-1171	3
α-helix	1174-1176	3
α-helix	1180-1192	13
α-helix	1193-1196	4
α-helix	1200-1202	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Spike protein S2',Chimeric protein mimic of SARS-CoV-2 Spike HR1	A	protein	241	Severe acute respiratory syndrome coronavirus 2	P0DTC2 (AlphaFold model)
Spike protein S2'	B	protein	44	Severe acute respiratory syndrome coronavirus 2	P0DTC2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7ZR2_1 Spike protein S2',Chimeric protein mimic of SARS-CoV-2 Spike HR1 (chains A)
MDVLYENQKLIANKFNSAIGKIQDSLSSTASELGKLQDEVNQNAQDLNTLVKQLSSNFGR
ISSELNDILSRLDKGEPAKDLRSDIDNLESKIAGFNSSLQKVLTNLAQKNQNVEDKLKGL
ESRTSSLEKQIKGIASNFQNEILKQREYLVNKGSGNVLYENQKLIENQFNSAIGKIQDSL
SSTKSALGKLKDVVNQNKQALNTLVKQLSSNFGAISSVLNDIKSRLDKVEGGGGSHHHHH
H

Sequence of entity 2 (B), FASTA

>7ZR2_2 Spike protein S2' (chains B)
XVDLGDISGINASVVNIQKEIDRLNEVAKNLNESLIDLQESGGY

Primary citation

Novel chimeric proteins mimicking SARS-CoV-2 spike epitopes with broad inhibitory activity. Cano-Munoz, M., Polo-Megias, D., Camara-Artigas, A. et al. Int J Biol Macromol (2022) 222:2467-2478. DOI 10.1016/j.ijbiomac.2022.10.031 · PubMed

Other PDB entries of the same protein (UniProt P0DTC2 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7Z8O 0.96 Å, Crystal structure of SARS-CoV-2 S RBD in complex with a stapled peptide
7Y8J 1.03 Å, 3D1 in complex with 6-mer HR1 peptide from SARS-CoV-2
9FC2 1.21 Å, The crystal structure of the SARS-CoV-2 receptor binding domain in complex with the…
7EK6 1.24 Å, Structure of viral peptides IPB19/N52
7EAM 1.4 Å, immune complex of SARS-CoV-2 RBD and cross-neutralizing antibody 7D6
7M53 1.4 Å, B6 Fab fragment bound to the SARS-CoV/SARS-CoV-2 spike stem helix peptide
8CMC 1.42 Å, Human Leukocyte Antigen class II allotype DR1 presenting SARS-CoV-2 Spike peptide S511-530
7M8U 1.45 Å, Crystal Structure of HLA-B*35:01 in complex with IPFAMQMAY, an 9-mer epitope from…
8D36 1.45 Å, Crystal structure of SARS-CoV-2 fusion peptide in complex with neutralizing antibody…
8ENS 1.45 Å, Crystal structure of beta'-COPI-WD40 domain in complex with SARS-CoV-2 spike tail…
8ENW 1.45 Å, Crystal structure of beta'-COPI-WD40 domain in complex with SARS-CoV-2 clientized spike…
6M1V 1.5 Å, Crystal structure of post fusion core of 2019-nCoV S2 subunit

Browse structure collections

About this viewer

MolViewer shows 7ZR2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.