Crystal structure of mutant AR-LBD (Q799E) bound to dihydrotestosterone. Determined by X-ray diffraction at 1.74 Å resolution. Released 22 Mar 2023.
Explore 7ZU2 in 3D Show helices and sheets RCSB PDB PDBe
7ZU2 contains 12 α-helices and 4 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 673-681 | 9 | |
| α-helix | 698-721 | 24 | |
| α-helix | 726-728 | 3 | |
| α-helix | 731-757 | 27 | |
| β-strand | 763-766 | 4 | 1 |
| β-strand | 769-771 | 3 | 1 |
| α-helix | 773-778 | 6 | |
| α-helix | 782-797 | 16 | |
| α-helix | 802-813 | 12 | |
| β-strand | 816-818 | 3 | 2 |
| α-helix | 825-843 | 19 | |
| α-helix | 854-883 | 30 | |
| α-helix | 885-888 | 4 | |
| α-helix | 894-902 | 9 | |
| α-helix | 904-908 | 5 | |
| β-strand | 912-914 | 3 | 2 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Androgen receptor | A | protein | 249 | Homo sapiens | P10275 (AlphaFold model) |
>7ZU2_1 Androgen receptor (chains A) PIFLNVLEAIEPGVVCAGHDNNQPDSFAALLSSLNELGERQLVHVVKWAKALPGFRNLHV DDQMAVIQYSWMGLMVFAMGWRSFTNVNSRMLYFAPDLVFNEYRMHKSRMYSQCVRMRHL SQEFGWLEITPQEFLCMKALLLFSIIPVDGLKNQKFFDELRMNYIKELDRIIACKRKNPT SCSRRFYQLTKLLDSVQPIARELHQFTFDLLIKSHMVSVDFPEMMAEIISVQVPKILSGK VKPIYFHTQ
| ID | Name | Formula | Copies |
|---|---|---|---|
| DHT | 5-alpha-dihydrotestosterone | C19 H30 O2 | 1 |
Water and common crystallization additives (IMD) are not listed.
A hotspot for posttranslational modifications on the androgen receptor dimer interface drives pathology and anti-androgen resistance. Alegre-Marti, A., Jimenez-Panizo, A., Martinez-Tebar, A. et al. Sci Adv (2023) 9:eade2175-eade2175. DOI 10.1126/sciadv.ade2175 · PubMed
Other PDB entries of the same protein (UniProt P10275 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 7ZU2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.