7ZZV: Prostatic acid phosphatase (PAP) fragment

Prostatic acid phosphatase (PAP) fragment (85-120). Determined by solution NMR. Released 15 Jun 2022.

Method: Solution NMR
Organism: Homo sapiens
Chains: 1
Atoms: 313
Mol. weight: 4.47 kDa
Released: 15 Jun 2022

Explore 7ZZV in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

7ZZV contains 1 α-helix and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	103-109	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Prostatic acid phosphatase	A	protein	36	Homo sapiens	P15309 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>7ZZV_1 Prostatic acid phosphatase (chains A)
IRKRYRKFLNESYKHEQVYIRSTDVDRTLMSAMTNL

Primary citation

Structure of amyloidogenic PAP(85-120) peptide by high-resolution NMR spectroscopy. Blokhin, D.S., Yulmetov, A.R., Kusova, A.M. et al. J Mol Struct (2022) 1253. DOI 10.1016/j.molstruc.2021.132294

Other PDB entries of the same protein (UniProt P15309 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3PPD 1.5 Å, GGVLVN segment from Human Prostatic Acid Phosphatase Residues 260-265, involved in…
9NMV 1.97 Å, TCR156 S32Halpha bound to HLA A*02:01-PAP
9NMY 2.01 Å, TCR156 S32Qalpha bound to HLA A*02:01-PAP
9NMU 2.1 Å, TCR156 bound to HLA A*02:01-PAP
9NMW 2.11 Å, TCR156 S30Ealpha S32Qalpha bound to HLA A*02:01-PAP
9NMX 2.19 Å, TCR156 S32Malpha variant bound to HLA A*02:01-PAP
1ND6 2.4 Å, Crystal Structures of Human Prostatic Acid Phosphatase in Complex with a Phosphate Ion…
9YTD 2.5 Å, Designed antibody vAB66 targeting PAP-HLA A*02:01
1ND5 2.9 Å, Crystal Structures of Human Prostatic Acid Phosphatase in Complex with a Phosphate Ion…
2HPA 2.9 Å, Structural origins of L(+)-tartrate inhibition of human prostatic acid phosphatase
8XJ4 3.19 Å, Structure of prostatic acid phosphatase in human semen
1CVI 3.2 Å, Crystal structure of human prostatic acid phosphatase

Browse structure collections

About this viewer

MolViewer shows 7ZZV directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.