8A2K: Human STING

human STING in complex with 2'-3'-cyclic-GMP-7-deaza(4-[(2-naphthyloxy)methyl]phenyl)-AMP. Determined by X-ray diffraction at 1.89 Å resolution. Released 12 Oct 2022.

Method: X-ray diffraction
Resolution: 1.89 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,969
Mol. weight: 55.1 kDa
Ligands: KXD
Released: 12 Oct 2022

Explore 8A2K in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8A2K contains 18 α-helices and 14 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	148-163	16
α-helix	164-168	5
α-helix	169-186	18
α-helix	193-195	3
β-strand	198-203	6	1
α-helix	213-215	3
β-strand	219-224	6	1
α-helix	225-227	3
β-strand	228-232	5	2
β-strand	235-240	6	2
β-strand	243-249	7	1
β-strand	252-261	10	1
α-helix	264-273	10
α-helix	281-301	21
β-strand	309-314	6	1
α-helix	325-336	12

Chain B: 9 helices, 7 β-strands

Element	Residues	Length	Sheet
α-helix	155-163	9
α-helix	164-168	5
α-helix	169-182	14
β-strand	198-203	6	3
α-helix	212-215	4
β-strand	219-224	6	3
α-helix	225-227	3
β-strand	228-232	5	4
β-strand	235-240	6	4
β-strand	243-249	7	3
β-strand	252-261	10	3
α-helix	264-271	8
α-helix	275-277	3
α-helix	281-301	21
β-strand	309-314	6	3
α-helix	325-337	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Stimulator of interferon genes protein	A, B	protein	241	Homo sapiens	Q86WV6 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8A2K_1 Stimulator of interferon genes protein (chains A, B)
SAPAEISAVCEKGNFNVAHGLAWSYYIGYLRLILPELQARIRTYNQHYNNLLRGAVSQRL
YILLPLDCGVPDNLSMADPNIRFLDKLPQQTGDRAGIKDRVYSNSIYELLENGQRAGTCV
LEYATPLQTLFAMSQYSQAGFSREDRLEQAKLFCRTLEDILADAPESQNNCRLIAYQEPA
DDSSFSLSQEVLRHLRQEEKEEVTVGSLKTSAVPSTSTMSQEPELLISGMEKPLPLRTDF
S

Ligands and cofactors

ID	Name	Formula	Copies
KXD	2-azanyl-9-[(1~{R},6~{R},8~{R},9~{R},10~{S},15~{R},17~{R},18~{R})-8-[4-azanyl-5…	C38 H37 N9 O14 P2	1

Primary citation

Design, Synthesis, and Biochemical and Biological Evaluation of Novel 7-Deazapurine Cyclic Dinucleotide Analogues as STING Receptor Agonists. Vavrina, Z., Perlikova, P., Milisavljevic, N. et al. J Med Chem (2022) 65:14082-14103. DOI 10.1021/acs.jmedchem.2c01305 · PubMed

Other PDB entries of the same protein (UniProt Q86WV6 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6MX3 1.36 Å, Crystal structure of human STING (G230A, H232R, R293Q) in complex with Compound 1
4EMT 1.5 Å, Crystal Structure of human STING bound to c-di-GMP
6UKZ 1.52 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound 6
9CUD 1.53 Å, Human STING G230A/R293Q variant bound to diABZI-i
6UKU 1.68 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound 3
7ZKU 1.7 Å, Crystal structure of human STING in complex with 3',3'-c-(2'F,2'dAMP-2'd<carba>GMP)
8STI 1.72 Å, human STING with agonist XMT-1616
6MX0 1.73 Å, Crystal structure of human STING apoprotein (G230A, H232R, R293Q)
6UKM 1.74 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound MSA-2
9VZG 1.74 Å, Harnessing Noncovalent Dimerization Enables an Orally Active STING Agonist for…
6UL0 1.76 Å, STING C-terminal Domain Complexed with Non-cyclic Dinucleotide Compound 4
6XNP 1.77 Å, Crystal Structure of Human STING CTD complex with SR-717

Browse structure collections

About this viewer

MolViewer shows 8A2K directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.