8A6L: 4F2hc cell-surface antigen heavy chain

Human 4F2hc-LAT2 heterodimeric amino acid transporter in complex with anticalin D11vs. Determined by electron microscopy at 3.18 Å resolution. Released 9 Nov 2022.

Method: Electron microscopy
Resolution: 3.18 Å
Organism: Homo sapiens
Chains: 3
Atoms: 8,477
Mol. weight: 142.4 kDa
Ligands: NAG
Released: 9 Nov 2022

Explore 8A6L in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8A6L contains 49 α-helices and 29 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	180-206	27
α-helix	208-214	7
α-helix	218-220	3
β-strand	224-228	5	1
α-helix	230-234	5
α-helix	241-244	4
α-helix	245-247	3
α-helix	248-254	7
β-strand	258-261	4	1
β-strand	265	1	2
β-strand	280	1	2
α-helix	287-300	14
β-strand	303-307	5	1
α-helix	324-340	17
β-strand	344-347	4	1
α-helix	350-352	3
α-helix	356-370	15
β-strand	375-380	6	1
α-helix	385-393	9
β-strand	399-402	4	1
α-helix	412-425	14
α-helix	441-444	4
α-helix	447-449	3
α-helix	450-459	10
β-strand	465-467	3	1
α-helix	487-489	3
α-helix	505-507	3
α-helix	509-513	5
α-helix	519-532	14
α-helix	534-537	4
β-strand	540-544	5	3
β-strand	550-556	7	3
β-strand	562-568	7	3
β-strand	574-575	2	4
α-helix	585-587	3
α-helix	588-590	3
β-strand	592-593	2	5
β-strand	594-598	5	3
β-strand	609-610	2	5
α-helix	611-613	3
β-strand	615-616	2	4
β-strand	621-626	6	3

Chain B: 21 helices, 0 β-strands

Element	Residues	Length
α-helix	44-53	10
α-helix	57-69	13
α-helix	72-99	28
α-helix	108-112	5
α-helix	119-125	7
α-helix	126-130	5
α-helix	131-147	17
α-helix	155-157	3
α-helix	158-178	21
α-helix	180-211	32
α-helix	231-242	12
α-helix	251-254	4
α-helix	261-290	30
α-helix	293-296	4
α-helix	302-310	9
α-helix	318-346	29
α-helix	365-378	14
α-helix	384-411	28
α-helix	425-444	20
α-helix	448-467	20
α-helix	477-491	15

Chain C: 4 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	9-12	4
α-helix	24-27	4
β-strand	29-37	9	6
β-strand	50	1	7
β-strand	53-58	6	6
α-helix	63	1
β-strand	64-71	8	6
β-strand	76-85	10	6
β-strand	91-94	4	6
β-strand	109-113	5	6
β-strand	118-124	7	6
β-strand	133-139	7	6
α-helix	146-158	13
β-strand	166-167	2	6
β-strand	170	1	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
4F2hc cell-surface antigen heavy chain	A	protein	546	Homo sapiens	P08195 (AlphaFold model)
Large neutral amino acids transporter small subunit 2	B	protein	549	Homo sapiens	Q9UHI5 (AlphaFold model)
Anticalin D11vs	C	protein	188	Homo sapiens

Sequence of entity 1 (A), FASTA

>8A6L_1 4F2hc cell-surface antigen heavy chain (chains A)
TMAHHHHHHHHHGIEGRMSQDTEVDMKEVELNELEPEKQPMNAASGAAMSLAGAEKNGLV
KIKVAEDEAEAAAAAKFTGLSKEELLKVAGSPGWVRTRWALLLLFWLGWLGMLAGAVVII
VRAPRCRELPAQKWWHTGALYRIGDLQAFQGHGAGNLAGLKGRLDYLSSLKVKGLVLGPI
HKNQKDDVAQTDLLQIDPNFGSKEDFDSLLQSAKKKSIRVILDLTPNYRGENSWFSTQVD
TVATKVKDALEFWLQAGVDGFQVRDIENLKDASSFLAEWQNITKGFSEDRLLIAGTNSSD
LQQILSLLESNKDLLLTSSYLSDSGSTGEHTKSLVTQYLNATGNRWCSWSLSQARLLTSF
LPAQLLRLYQLMLFTLPGTPVFSYGDEIGLDAAALPGQPMEAPVMLWDESSFPDIPGAVS
ANMTVKGQSEDPGSLLSLFRRLSDQRSKERSLLHGDFHAFSAGPGLFSYIRHWDQNERFL
VVLNFGDVGLSAGLQASDLPASASLPAKADLLLSTQPGREEGSPLELERLKLEPHEGLLL
RFPYAA

Sequence of entity 2 (B), FASTA

>8A6L_2 Large neutral amino acids transporter small subunit 2 (chains B)
MAWSHPQFEKIEGRMEEGARHRNNTEKKHPGGGESDASPEAGSGGGGVALKKEIGLVSAC
GIIVGNIIGSGIFVSPKGVLENAGSVGLALIVWIVTGFITVVGALCYAELGVTIPKSGGD
YSYVKDIFGGLAGFLRLWIAVLVIYPTNQAVIALTFSNYVLQPLFPTCFPPESGLRLLAA
ICLLLLTWVNCSSVRWATRVQDIFTAGKLLALALIIIMGIVQICKGEYFWLEPKNAFENF
QEPDIGLVALAFLQGSFAYGGWNFLNYVTEELVDPYKNLPRAIFISIPLVTFVYVFANVA
YVTAMSPQELLASNAVAVTFGEKLLGVMAWIMPISVALSTFGGVNGSLFTSSRLFFAGAR
EGHLPSVLAMIHVKRCTPIPALLFTCISTLLMLVTSDMYTLINYVGFINYLFYGVTVAGQ
IVLRWKKPDIPRPIKINLLFPIIYLLFWAFLLVFSLWSEPVVCGIGLAIMLTGVPVYFLG
VYWQHKPKCFSDFIELLTLVSQKMCVVVYPEVERGSGTEEANEDMEEQQQPMYQPTPTKD
KDVAGQPQP

Sequence of entity 3 (C), FASTA

>8A6L_3 Anticalin D11vs (chains C)
QDSTSDLIPAPPLSKVPLQQNFQDNQFHGKWYVVGRAGNTGLREDKDPGKMFATIYELKE
DKSYNVTYVWSGQKKCMYSIVTFVPGSQPGEFTLGNIKSAPGRTSWLVRVVSTNYNQHAM
VFFKSVTQNREGFAITLYGRTKELTSELKENFIRFSKSLGLPENHIVFPVPIDQCIDGSA
WSHPQFEK

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	4

Primary citation

Structure of the human heterodimeric transporter 4F2hc-LAT2 in complex with Anticalin, an alternative binding protein for applications in single-particle cryo-EM. Jeckelmann, J.M., Lemmin, T., Schlapschy, M. et al. Sci Rep (2022) 12:18269-18269. DOI 10.1038/s41598-022-23270-1 · PubMed

Other PDB entries of the same protein (UniProt P08195 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6S8V 1.8 Å, Structure of the high affinity Anticalin P3D11 in complex with the human CD98 heavy…
2DH2 2.1 Å, Crystal Structure of human ED-4F2hc
8G0M 2.25 Å, Structure of complex between TV6.6 and CD98hc ECD
9KJU 2.7 Å, Local refinement of the y+LAT1-4F2hc bound with Arg
2DH3 2.8 Å, Crystal Structure of human ED-4F2hc
7DF1 2.81 Å, Crystal structure of human CD98 heavy chain extracellular domain in complex with S1-F4…
7CMI 2.9 Å, The LAT2-4F2hc complex in complex with leucine
7DSK 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-075
7DSL 2.9 Å, Overall structure of the LAT1-4F2hc bound with JX-078
8YLP 2.9 Å, Overall structure of the y+LAT1-4F2hc bound with Arg
7DSN 3.1 Å, Overall structure of the LAT1-4F2hc bound with JX-119
8X0W 3.1 Å, Overall structure of the LAT1-4F2hc bound with Leu

Browse structure collections

About this viewer

MolViewer shows 8A6L directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.