8AFE: Crescentin filaments

Cryo-EM structure of crescentin filaments (stutter mutant, C1 symmetry and small box). Determined by electron microscopy at 3.3 Å resolution. Released 16 Aug 2023.

Method: Electron microscopy
Resolution: 3.3 Å
Organisms: Caulobacter vibrioides, Camelidae
Chains: 10
Atoms: 6,785
Mol. weight: 708.23 kDa
Released: 16 Aug 2023

Explore 8AFE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8AFE contains 19 α-helices and 57 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	351-356	6
α-helix	358-440	83

Chain B: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	353-427	75
α-helix	428-434	7
α-helix	435-441	7
α-helix	442-445	4

Chain C: 1 helix, 16 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	4
β-strand	5-7	3	5
β-strand	11-12	2	6
β-strand	791-796	6	5
β-strand	807-811	5	7
β-strand	812	1	8
β-strand	819-824	6	7
β-strand	830-832	3	7
β-strand	840-845	6	5
β-strand	850-855	6	5
α-helix	860-862	3
β-strand	864-866	3	8
β-strand	868-871	4	7
β-strand	876-877	2	7
β-strand	879	1	4
β-strand	882-884	3	8
β-strand	885-886	2	6

Chain D: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	6-7	2	1
β-strand	10-12	3	2
β-strand	790-796	7	1
β-strand	807-812	6	2
β-strand	818-824	7	2
β-strand	831-832	2	2
β-strand	840-845	6	1
β-strand	850-856	7	1
α-helix	860-862	3
β-strand	864-868	5	2
β-strand	870-872	3	3
β-strand	875-877	3	3
β-strand	882-886	5	2

Chain E: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	86-110	25
α-helix	111-115	5
α-helix	116-162	47

Chain F: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	87-162	76

Chain G: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	404-438	35
α-helix	439-443	5

Chain H: 3 helices, 0 β-strands

Element	Residues	Length
α-helix	406-427	22
α-helix	428-434	7
α-helix	435-440	6

2 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Crescentin	A, B, E, F, G, H	protein	460	Caulobacter vibrioides	A0A0H3CD98 (AlphaFold model)
Crescentin-specific megabody MB13	C, D, I, J	protein	907	Camelidae	P42592 (AlphaFold model)

Sequence of entity 1 (A, B, E, F, G, H), FASTA

>8AFE_1 Crescentin (chains A, B, E, F, G, H)
MRLLSKNSRETKNGKPTVLGDEARAEAMQHQIESTQAIGQRYETIHGGLDSIGRVMEHLK
AIEPLIAEIRGPVSQEFEARRAEHAELIAVRANLDQAQRQIALIQAEEREVSARLAAAET
ALGESDARRQTQDAALEDNALEIDRLRNALLQSDLKVSSLDASLRDATARIEHLVQDVEG
LRVQAQDIDARRGDAEAALARANQDNALLGEEAATLKKRVDQAGLDLARLSRIETDLEAQ
LAAERARVQAVENALAAHQADSGRTIRGLESQVEANRAEISALQTRLETATGRADKLEEM
NGQISARLADSSAQQKAVERRAGDLNVALERALDRIRALEEEADGLRQRHAGVDTARATA
IERADQLAKSAVAQEKALKRAEERAQQLRARLDAMQEAQDQVRRDSATHEAKIAELQATI
ERLTSEAALAEGALEAARRDRSRLQMALLGASDGDVAASA

Sequence of entity 2 (C, D, I, J), FASTA

>8AFE_2 Crescentin-specific megabody MB13 (chains C, D, I, J)
EVQLQESGGGLVYKEETQSGLNNYARVVEKGQYDSLEIPAQVAASWESGRDDAAVFGFID
KEQLDKYVANGGKRSDWTVKFAENRSQDGTLLGYSLLQESVDQASYMYSDNHYLAEMATI
LGKPEEAKRYRQLAQQLADYINTCMFDPTTQFYYDVRIEDKPLANGCAGKPIVERGKGPE
GWSPLFNGAATQANADAVVKVMLDPKEFNTFVPLGTAALTNPAFGADIYWRGRVWVDQFW
FGLKGMERYGYRDDALKLADTFFRHAKGLTADGPIQENYNPLTGAQQGAPNFSWSAAHLY
MLYNDFFRKQASGGGSGGGGSGGGGSGNADNYKNVINRTGAPQYMKDYDYDDHQRFNPFF
DLGAWHGHLLPDGPNTMGGFPGVALLTEEYINFMASNFDRLTVWQDGKKVDFTLEAYSIP
GALVQKLTAKDVQVEMTLRFATPRTSLLETKITSNKPLDLVWDGELLEKLEAKEGKPLSD
KTIAGEYPDYQRKISATRDGLKVTFGKVRATWDLLTSGESEYQVHKSLPVQTEINGNRFT
SKAHINGSTTLYTTYSHLLTAQEVSKEQMQIRDILARPAFYLTASQQRWEEYLKKGLTNP
DATPEQTRVAVKAIETLNGNWRSPGGAVKFNTVTPSVTGRWFSGNQTWPWDTWKQAFAMA
HFNPDIAKENIRAVFSWQIQPGDSVRPQDVGFVPDLIAWNLSPERGGDGGNWNERNTKPS
LAAWSVMEVYNVTQDKTWVAEMYPKLVAYHDWWLRNRDHNGNGVPEYGATRDKAHNTESG
EMLFTVKKDSLRLSCASSRSIDGINIMRWYRQAPGKQRGMVAVVTGWGSTNYVDSVKGRF
IISRDSAKDTVYLQMNNLKPEDTAVYSCNAIYRGSEYWGQGTQVTVSSGENLYFQGSHHH
HHHHHHH

Primary citation

Filament structure and subcellular organization of the bacterial intermediate filament-like protein crescentin. Liu, Y., van den Ent, F., Lowe, J. Proc Natl Acad Sci U S A (2024) 121:e2309984121-e2309984121. DOI 10.1073/pnas.2309984121 · PubMed

Other PDB entries of the same protein (UniProt A0A0H3CD98 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8AFH 3.9 Å, Cryo-EM structure of crescentin filaments (stutter mutant, C2, symmetry and small box)
8AHL 4.1 Å, Cryo-EM structure of crescentin filaments (stutter mutant, C1 symmetry and large box)
8AJB 4.3 Å, Cryo-EM structure of crescentin filaments (stutter mutant, C2 symmetry and large box)
8AFL 4.4 Å, Cryo-EM structure of crescentin filaments (wildtype, C1 symmetry and small box)
8AFM 4.8 Å, Cryo-EM structure of crescentin filaments (wildtype, C2 symmetry and small box)
8AIA 5.1 Å, Cryo-EM structure of crescentin filaments (wildtype, C1 symmetry and large box)
8AIX 5.8 Å, Cryo-EM structure of crescentin filaments (wildtype, C2 symmetry and large box)

Browse structure collections

About this viewer

MolViewer shows 8AFE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.