8AIX: Crescentin filaments

Cryo-EM structure of crescentin filaments (wildtype, C2 symmetry and large box). Determined by electron microscopy at 5.8 Å resolution. Released 16 Aug 2023.

Method: Electron microscopy
Resolution: 5.8 Å
Organisms: Caulobacter vibrioides, Camelidae
Chains: 24
Atoms: 21,924
Mol. weight: 1613.02 kDa
Released: 16 Aug 2023

Explore 8AIX in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8AIX contains 60 α-helices and 78 β-strands across 24 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A and E: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	359-435	77
α-helix	436-438	3

Chains B and F: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	359	1
α-helix	360-364	5
α-helix	365-424	60
α-helix	425-429	5
α-helix	430-438	9

Chains C and O: 2 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	794-795	2	8
β-strand	807-812	6	9
β-strand	818-824	7	9
β-strand	830-832	3	9
α-helix	834-836	3
β-strand	842-843	2	8
β-strand	851-853	3	8
α-helix	860-862	3
β-strand	865-869	5	9

Chains D and P: 2 helices, 10 β-strands

Element	Residues	Length	Sheet
β-strand	4-7	4	1
β-strand	794-797	4	1
β-strand	807-811	5	2
β-strand	819-824	6	2
β-strand	831-832	2	2
α-helix	834-836	3
β-strand	851	1	1
α-helix	860-862	3
β-strand	864-866	3	2
β-strand	869-872	4	2
β-strand	875-878	4	2
β-strand	882-884	3	2

Chains G and Q: 5 helices, 0 β-strands

Element	Residues	Length
α-helix	35-59	25
α-helix	62-65	4
α-helix	75-93	19
α-helix	97-159	63
α-helix	161-214	54

Chains H and R: 4 helices, 0 β-strands

Element	Residues	Length
α-helix	39-67	29
α-helix	71-85	15
α-helix	87-159	73
α-helix	161-214	54

Chains I and S: 1 helix, 9 β-strands

Element	Residues	Length	Sheet
β-strand	795	1	10
β-strand	807-810	4	11
β-strand	822-824	3	11
β-strand	840-845	6	10
α-helix	846-848	3
β-strand	850-855	6	10
β-strand	864-866	3	12
β-strand	867-872	6	11
β-strand	875-877	3	11
β-strand	882-884	3	12

Chains J and T: 2 helices, 13 β-strands

Element	Residues	Length	Sheet
β-strand	4-5	2	3
β-strand	795	1	4
β-strand	796-797	2	3
β-strand	807-812	6	5
β-strand	819-824	6	5
β-strand	832	1	5
α-helix	834-836	3
β-strand	840-843	4	6
β-strand	851	1	4
β-strand	852-855	4	6
α-helix	860-862	3
β-strand	865-870	6	5
β-strand	871-872	2	7
β-strand	875-876	2	7
β-strand	882	1	5

4 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Crescentin	A, B, E, F, G, H, K, L, M, N, Q, R, U, V, W, X	protein	457	Caulobacter vibrioides	A0A0H3CD98 (AlphaFold model)
Crescentin-specific megabody MB13	C, D, I, J, O, P, S, T	protein	907	Camelidae	P42592 (AlphaFold model)

Sequence of entity 1 (A, B, E, F, G, H, K, L, M, N, Q, R, U, V, W, X), FASTA

>8AIX_1 Crescentin (chains A, B, E, F, G, H, K, L, M, N, Q, R, U, V, W, X)
MRLLSKNSRETKNGKPTVLGDEARAEAMQHQIESTQAIGQRYETIHGGLDSIGRVMEHLK
AIEPLIAEIRGPVSQEFEARRAEHAELIAVRANLDQAQRQIALIQAEEREVSARLAAAET
ALGESDARRQTQDAALEDNALEIDRLRNALLQSDLKVSSLDASLRDATARIEHLVQDVEG
LRVQAQDIDARRGDAEAALARANQDNALLGEEAATLKKRVDQAGLDLARLSRIETDLEAQ
LAAERARVQAVENALAAHQADSGRTIRGLESQVEANRAEISALQTRLETATGRADKLEEM
NGQISARLADSSAQQKAVERRAGDLNVALERALDRIRALEEEADGLRQRHAGVDTARATA
IERADQLAKSAVAQEKALKRAEERAQQLRARLDAMQEAQDQVRRDHEAKIAELQATIERL
TSEAALAEGALEAARRDRSRLQMALLGASDGDVAASA

Sequence of entity 2 (C, D, I, J, O, P, S, T), FASTA

>8AIX_2 Crescentin-specific megabody MB13 (chains C, D, I, J, O, P, S, T)
EVQLQESGGGLVYKEETQSGLNNYARVVEKGQYDSLEIPAQVAASWESGRDDAAVFGFID
KEQLDKYVANGGKRSDWTVKFAENRSQDGTLLGYSLLQESVDQASYMYSDNHYLAEMATI
LGKPEEAKRYRQLAQQLADYINTCMFDPTTQFYYDVRIEDKPLANGCAGKPIVERGKGPE
GWSPLFNGAATQANADAVVKVMLDPKEFNTFVPLGTAALTNPAFGADIYWRGRVWVDQFW
FGLKGMERYGYRDDALKLADTFFRHAKGLTADGPIQENYNPLTGAQQGAPNFSWSAAHLY
MLYNDFFRKQASGGGSGGGGSGGGGSGNADNYKNVINRTGAPQYMKDYDYDDHQRFNPFF
DLGAWHGHLLPDGPNTMGGFPGVALLTEEYINFMASNFDRLTVWQDGKKVDFTLEAYSIP
GALVQKLTAKDVQVEMTLRFATPRTSLLETKITSNKPLDLVWDGELLEKLEAKEGKPLSD
KTIAGEYPDYQRKISATRDGLKVTFGKVRATWDLLTSGESEYQVHKSLPVQTEINGNRFT
SKAHINGSTTLYTTYSHLLTAQEVSKEQMQIRDILARPAFYLTASQQRWEEYLKKGLTNP
DATPEQTRVAVKAIETLNGNWRSPGGAVKFNTVTPSVTGRWFSGNQTWPWDTWKQAFAMA
HFNPDIAKENIRAVFSWQIQPGDSVRPQDVGFVPDLIAWNLSPERGGDGGNWNERNTKPS
LAAWSVMEVYNVTQDKTWVAEMYPKLVAYHDWWLRNRDHNGNGVPEYGATRDKAHNTESG
EMLFTVKKDSLRLSCASSRSIDGINIMRWYRQAPGKQRGMVAVVTGWGSTNYVDSVKGRF
IISRDSAKDTVYLQMNNLKPEDTAVYSCNAIYRGSEYWGQGTQVTVSSGENLYFQGSHHH
HHHHHHH

Primary citation

Filament structure and subcellular organization of the bacterial intermediate filament-like protein crescentin. Liu, Y., van den Ent, F., Lowe, J. Proc Natl Acad Sci U S A (2024) 121:e2309984121-e2309984121. DOI 10.1073/pnas.2309984121 · PubMed

Other PDB entries of the same protein (UniProt A0A0H3CD98 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8AFE 3.3 Å, Cryo-EM structure of crescentin filaments (stutter mutant, C1 symmetry and small box)
8AFH 3.9 Å, Cryo-EM structure of crescentin filaments (stutter mutant, C2, symmetry and small box)
8AHL 4.1 Å, Cryo-EM structure of crescentin filaments (stutter mutant, C1 symmetry and large box)
8AJB 4.3 Å, Cryo-EM structure of crescentin filaments (stutter mutant, C2 symmetry and large box)
8AFL 4.4 Å, Cryo-EM structure of crescentin filaments (wildtype, C1 symmetry and small box)
8AFM 4.8 Å, Cryo-EM structure of crescentin filaments (wildtype, C2 symmetry and small box)
8AIA 5.1 Å, Cryo-EM structure of crescentin filaments (wildtype, C1 symmetry and large box)

Browse structure collections

About this viewer

MolViewer shows 8AIX directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.