8AGZ: 60S ribosomal protein L15-A
Yeast RQC complex in state with the RING domain of Ltn1 in the OUT position. Determined by electron microscopy at 2.6 Å resolution. Released 8 Mar 2023.
- Method
- Electron microscopy
- Resolution
- 2.6 Å
- Organism
- Saccharomyces cerevisiae
- Chains
- 54
- Atoms
- 151,339
- Mol. weight
- 2401.27 kDa
- Ligands
- MG, ZN, SPD
- Released
- 8 Mar 2023
Explore 8AGZ in 3D
Show helices and sheets
RCSB PDB
PDBe
Secondary structure: helices and β-sheets
8AGZ contains 473 α-helices and 391 β-strands across 49 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
Chain 0: 6 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-21 | 18 | |
| β-strand | 24-29 | 6 | 5 |
| α-helix | 35-44 | 10 | |
| β-strand | 49-53 | 5 | 5 |
| α-helix | 56-65 | 10 | |
| α-helix | 71-75 | 5 | |
| α-helix | 76-79 | 4 | |
| β-strand | 85-89 | 5 | 5 |
| α-helix | 94-102 | 9 | |
| β-strand | 186-192 | 7 | 5 |
| β-strand | 195-197 | 3 | 5 |
Chain 1: 1 helix, 0 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 50-52 | 3 | |
Chain a: 37 helices, 38 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 7-20 | 14 | |
| β-strand | 25-31 | 7 | 87 |
| β-strand | 38-45 | 8 | 87 |
| β-strand | 48-55 | 8 | 87 |
| β-strand | 59-63 | 5 | 87 |
| β-strand | 65 | 1 | 88 |
| α-helix | 75-83 | 9 | |
| β-strand | 88 | 1 | 87 |
| β-strand | 89-94 | 6 | 89 |
| β-strand | 100-105 | 6 | 89 |
| β-strand | 110-115 | 6 | 89 |
| β-strand | 122-125 | 4 | 89 |
| β-strand | 130 | 1 | 90 |
| β-strand | 131-134 | 4 | 89 |
| β-strand | 138 | 1 | 91 |
| β-strand | 143 | 1 | 91 |
| β-strand | 148 | 1 | 90 |
| α-helix | 154-158 | 5 | |
| α-helix | 162-173 | 12 | |
| α-helix | 178-204 | 27 | |
| α-helix | 220-227 | 8 | |
| α-helix | 233-242 | 10 | |
| α-helix | 251-256 | 6 | |
| α-helix | 258-277 | 20 | |
| β-strand | 282-289 | 8 | 92 |
| α-helix | 290 | 1 | |
| α-helix | 300-303 | 4 | |
| β-strand | 304-310 | 7 | 92 |
| α-helix | 313-315 | 3 | |
| α-helix | 318-323 | 6 | |
| β-strand | 324-330 | 7 | 92 |
| α-helix | 334-394 | 61 | |
| α-helix | 396-410 | 15 | |
| α-helix | 416-428 | 13 | |
| α-helix | 432-435 | 4 | |
| β-strand | 437 | 1 | 93 |
| β-strand | 442 | 1 | 93 |
| α-helix | 443-445 | 3 | |
| β-strand | 447-453 | 7 | 93 |
| β-strand | 503-509 | 7 | 93 |
| α-helix | 514-560 | 47 | |
| β-strand | 567 | 1 | 88 |
| α-helix | 568-572 | 5 | |
| β-strand | 578-581 | 4 | 94 |
| β-strand | 587-590 | 4 | 94 |
| α-helix | 594-603 | 10 | |
| β-strand | 610-613 | 4 | 94 |
| β-strand | 620-622 | 3 | 94 |
| α-helix | 629-631 | 3 | |
| α-helix | 632-645 | 14 | |
| α-helix | 648-651 | 4 | |
| β-strand | 658-661 | 4 | 94 |
| β-strand | 665-666 | 2 | 95 |
| α-helix | 670-672 | 3 | |
| α-helix | 675-677 | 3 | |
| β-strand | 682-683 | 2 | 95 |
| β-strand | 690-691 | 2 | 94 |
| α-helix | 692-694 | 3 | |
| β-strand | 699-707 | 9 | 96 |
| α-helix | 841-850 | 10 | |
| α-helix | 856-866 | 11 | |
| α-helix | 868-904 | 37 | |
| α-helix | 905-907 | 3 | |
| α-helix | 917-923 | 7 | |
| β-strand | 924-925 | 2 | 96 |
| α-helix | 932-933 | 2 | |
| β-strand | 934-943 | 10 | 96 |
| α-helix | 944-947 | 4 | |
| β-strand | 952-957 | 6 | 96 |
| α-helix | 963-975 | 13 | |
| β-strand | 979 | 1 | 97 |
| β-strand | 989 | 1 | 97 |
| α-helix | 991-999 | 9 | |
| α-helix | 1002-1008 | 7 | |
| β-strand | 1015-1016 | 2 | 96 |
Chain A: 13 helices, 5 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 4-11 | 8 | |
| α-helix | 17-31 | 15 | |
| β-strand | 36-39 | 4 | 1 |
| α-helix | 45-51 | 7 | |
| β-strand | 59-67 | 9 | 1 |
| α-helix | 76-78 | 3 | |
| α-helix | 84-86 | 3 | |
| α-helix | 98-109 | 12 | |
| β-strand | 114-123 | 10 | 1 |
| β-strand | 127-135 | 9 | 1 |
| α-helix | 140-143 | 4 | |
| α-helix | 149-152 | 4 | |
| α-helix | 154-156 | 3 | |
| α-helix | 159-162 | 4 | |
| α-helix | 166-172 | 7 | |
| α-helix | 178-180 | 3 | |
| α-helix | 187-195 | 9 | |
| β-strand | 197-199 | 3 | 2 |
Chain b: 2 helices, 6 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 3 | 1 | 3 |
| β-strand | 7-12 | 6 | 4 |
| β-strand | 19-27 | 9 | 4 |
| α-helix | 32-34 | 3 | |
| α-helix | 38-47 | 10 | |
| β-strand | 67-74 | 8 | 4 |
| β-strand | 80-87 | 8 | 4 |
| β-strand | 92 | 1 | 3 |
Chain B: 11 helices, 12 β-strands
| Element | Residues | Length | Sheet |
|---|
| β-strand | 6-10 | 5 | 6 |
| β-strand | 14 | 1 | 7 |
| β-strand | 15 | 1 | 8 |
| α-helix | 16-29 | 14 | |
| β-strand | 32-36 | 5 | 6 |
| α-helix | 38-40 | 3 | |
| β-strand | 42-44 | 3 | 8 |
| α-helix | 47-58 | 12 | |
| α-helix | 66-68 | 3 | |
| α-helix | 76-85 | 10 | |
| α-helix | 93-99 | 7 | |
| β-strand | 102-104 | 3 | 6 |
| β-strand | 118 | 1 | 6 |
| β-strand | 119 | 1 | 9 |
| β-strand | 124 | 1 | 7 |
| α-helix | 125-128 | 4 | |
| α-helix | 130 | 1 | |
| β-strand | 131 | 1 | 10 |
| β-strand | 133 | 1 | 10 |
| β-strand | 135-137 | 3 | 8 |
| α-helix | 138-145 | 8 | |
| α-helix | 150-184 | 35 | |
| α-helix | 189-196 | 8 | |
Chain c: 3 helices, 4 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 9-14 | 6 | |
| α-helix | 20-34 | 15 | |
| β-strand | 37 | 1 | 11 |
| β-strand | 47-51 | 5 | 11 |
| β-strand | 54-57 | 4 | 11 |
| β-strand | 63-65 | 3 | 11 |
| α-helix | 74-91 | 18 | |
Chain C: 8 helices, 10 β-strands
| Element | Residues | Length | Sheet |
|---|
| α-helix | 11-13 | 3 | |
| β-strand | 14-22 | 9 | 12 |
| α-helix | 26-36 | 11 | |
| β-strand | 40 | 1 | 12 |
| α-helix | 41-52 | 12 | |
| β-strand | 58-59 | 2 | 13 |
| α-helix | 67-68 | 2 | |
| β-strand | 69 | 1 | 14 |
| α-helix | 71-73 | 3 | |
| β-strand | 80 | 1 | 14 |
| β-strand | 81-82 | 2 | 13 |
| α-helix | 85-105 | 21 | |
| β-strand | 112-121 | 10 | 12 |
| α-helix | 122-124 | 3 | |
| β-strand | 125-131 | 7 | 15 |
| β-strand | 135-141 | 7 | 15 |
| β-strand | 144-152 | 9 | 12 |
| α-helix | 170-182 | 13 | |
41 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.
Molecules and chains
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|
| 60S ribosomal protein L15-A | A | protein | 204 | Saccharomyces cerevisiae | P05748 (AlphaFold model) |
| 60S ribosomal protein L16-A | B | protein | 199 | Saccharomyces cerevisiae | P26784 (AlphaFold model) |
| 60S ribosomal protein L17-A | C | protein | 184 | Saccharomyces cerevisiae | P05740 (AlphaFold model) |
| 60S ribosomal protein L18-A | D | protein | 186 | Saccharomyces cerevisiae | P0CX49 (AlphaFold model) |
| 60S ribosomal protein L19-A | E | protein | 189 | Saccharomyces cerevisiae | P0CX82 |
| 60S ribosomal protein L20-A | F | protein | 172 | Saccharomyces cerevisiae | P0CX23 |
| 60S ribosomal protein L21-A | G | protein | 160 | Saccharomyces cerevisiae | Q02753 |
| 60S ribosomal protein L22-A | H | protein | 121 | Saccharomyces cerevisiae | P05749 |
| 60S ribosomal protein L23-A | I | protein | 137 | Saccharomyces cerevisiae | P0CX41 |
| 60S ribosomal protein L24-A | J | protein | 155 | Saccharomyces cerevisiae | P04449 |
| 60S ribosomal protein L25 | K | protein | 142 | Saccharomyces cerevisiae | P04456 |
| 60S ribosomal protein L26-A | L | protein | 127 | Saccharomyces cerevisiae | P05743 |
41 more molecules are not listed.
Sequence of entity 1 (A), FASTA
>8AGZ_1 60S ribosomal protein L15-A (chains A)
MGAYKYLEELQRKKQSDVLRFLQRVRVWEYRQKNVIHRAARPTRPDKARRLGYKAKQGFV
IYRVRVRRGNRKRPVPKGATYGKPTNQGVNELKYQRSLRATAEERVGRRAANLRVLNSYW
VNQDSTYKYFEVILVDPQHKAIRRDARYNWICDPVHKHREARGLTATGKKSRGINKGHKF
NNTKAGRRKTWKRQNTLSLWRYRK
Sequence of entity 2 (B), FASTA
>8AGZ_2 60S ribosomal protein L16-A (chains B)
MSVEPVVVIDGKGHLVGRLASVVAKQLLNGQKIVVVRAEELNISGEFFRNKLKYHDFLRK
ATAFNKTRGPFHFRAPSRIFYKALRGMVSHKTARGKAALERLKVFEGIPPPYDKKKRVVV
PQALRVLRLKPGRKYTTLGKLSTSVGWKYEDVVAKLEAKRKVSSAEYYAKKRAFTKKVAS
ANATAAESDVAKQLAALGY
Sequence of entity 3 (C), FASTA
>8AGZ_3 60S ribosomal protein L17-A (chains C)
MARYGATSTNPAKSASARGSYLRVSFKNTRETAQAINGWELTKAQKYLEQVLDHQRAIPF
RRFNSSIGRTAQGKEFGVTKARWPAKSVKFVQGLLQNAAANAEAKGLDATKLYVSHIQVN
QAPKQRRRTYRAHGRINKYESSPSHIELVVTEKEEAVAKAAEKKVVRLTSRQRGRIAAQK
RIAA
Sequence of entity 4 (D), FASTA
>8AGZ_4 60S ribosomal protein L18-A (chains D)
MGIDHTSKQHKRSGHRTAPKSDNVYLKLLVKLYTFLARRTDAPFNKVVLKALFLSKINRP
PVSVSRIARALKQEGAANKTVVVVGTVTDDARIFEFPKTTVAALRFTAGARAKIVKAGGE
CITLDQLAVRAPKGQNTLILRGPRNSREAVRHFGMGPHKGKAPRILSTGRKFERARGRRR
SKGFKV
Sequence of entity 5 (E), FASTA
>8AGZ_5 60S ribosomal protein L19-A (chains E)
MANLRTQKRLAASVVGVGKRKVWLDPNETSEIAQANSRNAIRKLVKNGTIVKKAVTVHSK
SRTRAHAQSKREGRHSGYGKRKGTREARLPSQVVWIRRLRVLRRLLAKYRDAGKIDKHLY
HVLYKESKGNAFKHKRALVEHIIQAKADAQREKALNEEAEARRLKNRAARDRRAQRVAEK
RDALLKEDA
Sequence of entity 6 (F), FASTA
>8AGZ_6 60S ribosomal protein L20-A (chains F)
MAHFKEYQVIGRRLPTESVPEPKLFRMRIFASNEVIAKSRYWYFLQKLHKVKKASGEIVS
INQINEAHPTKVKNFGVWVRYDSRSGTHNMYKEIRDVSRVAAVETLYQDMAARHRARFRS
IHILKVAEIEKTADVKRQYVKQFLTKDLKFPLPHRVQKSTKTFSYKRPSTFY
Sequence of entity 7 (G), FASTA
>8AGZ_7 60S ribosomal protein L21-A (chains G)
MGKSHGYRSRTRYMFQRDFRKHGAVHLSTYLKVYKVGDIVDIKANGSIQKGMPHKFYQGK
TGVVYNVTKSSVGVIINKMVGNRYLEKRLNLRVEHIKHSKCRQEFLERVKANAAKRAEAK
AQGVAVQLKRQPAQPRESRIVSTEGNVPQTLAPVPYETFI
Sequence of entity 8 (H), FASTA
>8AGZ_8 60S ribosomal protein L22-A (chains H)
MAPNTSRKQKIAKTFTVDVSSPTENGVFDPASYAKYLIDHIKVEGAVGNLGNAVTVTEDG
TVVTVVSTAKFSGKYLKYLTKKYLKKNQLRDWIRFVSTKTNEYRLAFYQVTPEEDEEEDE
E
Sequence of entity 9 (I), FASTA
>8AGZ_9 60S ribosomal protein L23-A (chains I)
MSGNGAQGTKFRISLGLPVGAIMNCADNSGARNLYIIAVKGSGSRLNRLPAASLGDMVMA
TVKKGKPELRKKVMPAIVVRQAKSWRRRDGVFLYFEDNAGVIANPKGEMKGSAITGPVGK
ECADLWPRVASNSGVVV
Sequence of entity 10 (J), FASTA
>8AGZ_10 60S ribosomal protein L24-A (chains J)
MKVEIDSFSGAKIYPGRGTLFVRGDSKIFRFQNSKSASLFKQRKNPRRIAWTVLFRKHHK
KGITEEVAKKRSRKTVKAQRPITGASLDLIKERRSLKPEVRKANREEKLKANKEKKKAEK
AARKAEKAKSAGTQSSKFSKQQAKGAFQKVAATSR
Sequence of entity 11 (K), FASTA
>8AGZ_11 60S ribosomal protein L25 (chains K)
MAPSAKATAAKKAVVKGTNGKKALKVRTSATFRLPKTLKLARAPKYASKAVPHYNRLDSY
KVIEQPITSETAMKKVEDGNILVFQVSMKANKYQIKKAVKELYEVDVLKVNTLVRPNGTK
KAYVRLTADYDALDIANRIGYI
Sequence of entity 12 (L), FASTA
>8AGZ_12 60S ribosomal protein L26-A (chains L)
MAKQSLDVSSDRRKARKAYFTAPSSQRRVLLSAPLSKELRAQYGIKALPIRRDDEVLVVR
GSKKGQEGKISSVYRLKFAVQVDKVTKEKVNGASVPINLHPSKLVITKLHLDKDRKALIQ
RKGGKLE
Ligands and cofactors
| ID | Name | Formula | Copies |
|---|
| MG | Magnesium ion | Mg | 13 |
| ZN | Zinc ion | Zn | 7 |
| SPD | Spermidine | C7 H19 N3 | 1 |
Primary citation
Molecular basis of eIF5A-dependent CAT tailing in eukaryotic ribosome-associated quality control. Tesina, P., Ebine, S., Buschauer, R. et al. Mol Cell (2023) 83:607-621.e4. DOI 10.1016/j.molcel.2023.01.020 · PubMed
Other PDB entries of the same protein (UniProt P05748 (AlphaFold model), which also has an AlphaFold model), best resolution first:
- 9PN5 1.75 Å, Composite map of hypomethylated 80S ribosome treated with hygromycin B
- 8CCS 1.97 Å, 80S S. cerevisiae ribosome with ligands in hybrid-1 pre-translocation (PRE-H1) complex
- 8CDR 2.04 Å, Translocation intermediate 2 (TI-2) of 80S S. cerevisiae ribosome with ligands and eEF2…
- 8CEH 2.05 Å, Translocation intermediate 4 (TI-4) of 80S S. cerevisiae ribosome with ligands and eEF2…
- 8P8N 2.15 Å, Mouse RPL39 integrated into the yeast 60S ribosomal subunit
- 8PFR 2.15 Å, Mouse RPL39L integrated into the yeast 60S ribosomal subunit
- 8EVT 2.2 Å, Hypopseudouridylated yeast 80S bound with Taura syndrome virus (TSV) internal ribosome…
- 8T2Y 2.2 Å, Hypomethylated yeast 80S bound with cycloheximide, P-site tRNA, and A-site tRNA,…
- 8P8U 2.23 Å, Yeast 60S ribosomal subunit
- 8CGN 2.28 Å, Non-rotated 80S S. cerevisiae ribosome with ligands
- 8ZHC 2.3 Å, pre-frameshift complex of yeast 80S ribosome with eRF1 and mRNA of WNV
- 7UOO 2.34 Å, Nucleoplasmic pre-60S intermediate of the Nog2 containing pre-rotation state
Browse structure collections
About this viewer
MolViewer shows 8AGZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.