Crystal Structure of the third PDZ domain of PSD-95 protein in the space group P21 at pH 4.0. Determined by X-ray diffraction at 1.63 Å resolution. Released 8 Mar 2023.
Explore 8AH6 in 3D Show helices and sheets RCSB PDB PDBe
8AH6 contains 6 α-helices and 16 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 302 | 1 | 1 |
| β-strand | 308 | 1 | 1 |
| β-strand | 312-317 | 6 | 2 |
| β-strand | 325-329 | 5 | 2 |
| β-strand | 336-341 | 6 | 2 |
| α-helix | 346-350 | 5 | |
| β-strand | 357-362 | 6 | 2 |
| β-strand | 365-366 | 2 | 2 |
| α-helix | 372-380 | 9 | |
| β-strand | 385-392 | 8 | 2 |
| α-helix | 394-400 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 302 | 1 | 3 |
| β-strand | 308 | 1 | 3 |
| β-strand | 312-317 | 6 | 4 |
| β-strand | 325-331 | 7 | 4 |
| β-strand | 334-341 | 8 | 4 |
| α-helix | 346-350 | 5 | |
| β-strand | 357-362 | 6 | 4 |
| β-strand | 365-366 | 2 | 4 |
| α-helix | 372-380 | 9 | |
| β-strand | 385-392 | 8 | 4 |
| α-helix | 394-401 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| cDNA FLJ50577, highly similar to Discs large homolog 4 | A, B | protein | 104 | Homo sapiens | P78352 (AlphaFold model) |
>8AH6_1 cDNA FLJ50577, highly similar to Discs large homolog 4 (chains A, B) MGLGEEDIPREPRRIVIHRGSTGLGFNIVGGEDGEGIFISFILAGGPADLSGELRKGDQI LSVNGVDLRNASHEQAAIALKNAGQTVTIIAQYKPEEYSRFEAK
pH-Driven Polymorphic Behaviour of the Third PDZ Domain of PSD95: The Role of Electrostatic Interactions. Salinas-Garcia, M.C., Plaza-Garrido, M., Gavira, J.A. et al. Crystals (Basel) (2023). DOI 10.3390/cryst13020218
Other PDB entries of the same protein (UniProt P78352 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8AH6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.