8ARM: LSSmScarlet2

Name: PDB 8ARM: Crystal structure of LSSmScarlet2
Published: 2022-11-02
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: fluorescent protein

Crystal structure of LSSmScarlet2. Determined by X-ray diffraction at 1.41 Å resolution. Released 2 Nov 2022.

Method: X-ray diffraction
Resolution: 1.41 Å
Organism: Discosoma sp.
Chains: 1
Atoms: 2,274
Mol. weight: 26.61 kDa
Released: 2 Nov 2022

Explore 8ARM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8ARM contains 8 α-helices and 13 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	5-8	4
β-strand	13-23	11	1
β-strand	26-37	12	1
β-strand	42-51	10	1
α-helix	53	1
α-helix	55	1
α-helix	59-61	3
α-helix	63-65	3
β-strand	76	1	1
α-helix	84-87	4
β-strand	93-101	9	1
β-strand	106-116	11	1
β-strand	119-129	11	1
β-strand	142-145	4	1
α-helix	146-147	2
β-strand	148-155	8	1
β-strand	158-169	12	1
β-strand	174-185	12	1
α-helix	190-192	3
β-strand	195-206	12	1
β-strand	212-222	11	1

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
LSSmScarlet2	A	protein	232	Discosoma sp.	Q9U6Y8 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8ARM_1 LSSmScarlet2 (chains A)
RSMVSKGEAVIKEFMRFKVHMEGSMNGHEFEIEGEGEGRPYEGTQTAKLKVTKGGPLPFS
WDILSPQFMYGSRAFTKHPADIPDYHKQSFPEGFKWERVMNFEDGGAVTVTQDTSLEDGT
LIYEVKLRGTNFPPDGPVMQKKTMGLEADTERLYPEDGVLKGDIKMALRLKGGGRYLAHV
RTTYKAKKPVLMPGAYNVDRKLDITSHNEDYTVVEQFERSEGRHSTGDMDELYK

Primary citation

LSSmScarlet2 and LSSmScarlet3, Chemically Stable Genetically Encoded Red Fluorescent Proteins with a Large Stokes' Shift. Subach, O.M., Vlaskina, A.V., Agapova, Y.K. et al. Int J Mol Sci (2022) 23. DOI 10.3390/ijms231911051 · PubMed

Other PDB entries of the same protein (UniProt Q9U6Y8 (AlphaFold model), which also has an AlphaFold model), best resolution first:

2H5O 1.08 Å, Crystal structure of mOrange
8B7G 1.3 Å, Structure of oxygen-degraded rsCherry
7ZCT 1.33 Å, Structure of the red fluorescent protein mScarlet3 at pH 7.5
9LSC 1.38 Å, Crystal structure of mRFP1 with a grafted calcium-binding sequence and two bound calcium…
1ZGO 1.4 Å, High Resolution Crystal Structure of the Discosoma Red Fluorescent Protein (DsRed)
7OIN 1.4 Å, Crystal structure of LSSmScarlet - a genetically encoded red fluorescent protein with a…
8ZXH 1.46 Å, Structure of the red fluorescent protein mScarlet3-H at pH 4.5
5LK4 1.47 Å, Structure of the Red Fluorescent Protein mScarlet at pH 7.8
8B65 1.55 Å, Structure of rsCherry crystallized in anaerobic conditions
2VAD 1.59 Å, Monomeric red fluorescent protein, DsRed.M1
2H5R 1.6 Å, Crystal structure of mStrawberry at pH 10.5
9LSA 1.62 Å, Crystal structure of mRFP1 with a grafted calcium-binding sequence and one bound calcium…

Browse structure collections

About this viewer

MolViewer shows 8ARM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.