8AS9: Talin-KANK1 complex

Crystal structure of the talin-KANK1 complex. Determined by X-ray diffraction at 3.4 Å resolution. Released 7 Jun 2023.

Method: X-ray diffraction
Resolution: 3.4 Å
Organisms: Homo sapiens, Mus musculus
Chains: 4
Atoms: 4,704
Mol. weight: 70.04 kDa
Released: 7 Jun 2023

Explore 8AS9 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8AS9 contains 29 α-helices and 17 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 7 β-strands

Element	Residues	Length	Sheet
β-strand	8-10	3	1
α-helix	14-27	14
β-strand	34-37	4	2
β-strand	38	1	3
β-strand	41	1	3
β-strand	44-45	2	2
α-helix	47-53	7
α-helix	55-62	8
α-helix	64-66	3
β-strand	71-73	3	2
α-helix	80-92	13
β-strand	94-98	5	4
α-helix	102-111	10
α-helix	115-126	12

Chain B: 7 helices, 5 β-strands

Element	Residues	Length	Sheet
β-strand	6-11	6	4
α-helix	14-27	14
β-strand	34-37	4	5
β-strand	42-45	4	5
α-helix	47-53	7
α-helix	55-62	8
α-helix	64-66	3
β-strand	71-73	3	5
α-helix	80-92	13
β-strand	94-96	3	1
α-helix	102-111	10
α-helix	115-125	11

Chain C: 11 helices, 2 β-strands

Element	Residues	Length	Sheet
α-helix	1357-1377	21
α-helix	1389-1415	27
α-helix	1419-1449	31
α-helix	1458-1460	3
α-helix	1466-1478	13
α-helix	1479-1481	3
β-strand	1483	1	7
β-strand	1486	1	7
α-helix	1492-1513	22
α-helix	1519-1544	26
α-helix	1555-1575	21
α-helix	1590-1622	33
α-helix	1627-1653	27

Chain D: 4 helices, 3 β-strands

Element	Residues	Length	Sheet
β-strand	3-5	3	6
α-helix	6	1
α-helix	7-9	3
β-strand	11-13	3	6
α-helix	15-24	10
β-strand	37-41	5	4
α-helix	47-50	4

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
B-cell lymphoma 6 protein	A, B	protein	137	Homo sapiens	P41182 (AlphaFold model)
KN-motif NCoR1 BBD fusion,Nuclear receptor corepressor 1	D	protein	51	Homo sapiens	O75376 (AlphaFold model), Q14678 (AlphaFold model)
Talin-1	C	protein	309	Mus musculus	P26039 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8AS9_1 B-cell lymphoma 6 protein (chains A, B)
GPSSDLYLRPGGGDSQIQFTRHASDVLLNLNRLRSRDILTDVVIVVSREQFRAHKTVLMA
CSGLFYSIFTDQLKRNLSVINLDPEINPEGFNILLDFMYTSRLNLREGNIMAVMATAMYL
QMEHVVDTCRKFIKASE

Sequence of entity 2 (D), FASTA

>8AS9_2 KN-motif NCoR1 BBD fusion,Nuclear receptor corepressor 1 (chains D)
PYFVETPYGFQLDLDFVKYVDDIQKGNTIKKGGGGITTIKEMGRSIHEIPR

Sequence of entity 3 (C), FASTA

>8AS9_3 Talin-1 (chains C)
GIDPFTKHGQKECDNALRQLETVRELLENPVQPINDMSYFGCLDSVMENSKVLGEAMTGI
SQNAKNGNLPEFGDAIATASKALCGFTEAAAQAAYLVGVSDPNSQAGQQGLVEPTQFARA
NQAIQMACQSLGEPGCTQAQVLSAATIVAKHTSALCNSCRLASARTANPTAKRQFVQSAK
EVANSTANLVKTIKALDGDFTEENRAQCRAATAPLLEAVDNLSAFASNPEFSSVPAQISP
EGRAAMEPIVISAKTMLESAGGLIQTARALAVNPRDPPRWSVLAGHSRTVSDSIKKLITS
MRDKAPGQL

Primary citation

The structural basis of the talin-KANK1 interaction that coordinates the actin and microtubule cytoskeletons at focal adhesions. Li, X., Goult, B.T., Ballestrem, C. et al. Open Biol (2023) 13:230058-230058. DOI 10.1098/rsob.230058 · PubMed

Other PDB entries of the same protein (UniProt P41182 (AlphaFold model), which also has an AlphaFold model), best resolution first:

7LWE 1.17 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-7629
7RV1 1.17 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8826
7OKL 1.2 Å, Crystal structure of human BCL6 BTB domain in complex with compound 13e
7LWF 1.22 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-9320
7RV4 1.25 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-9153
7RV8 1.25 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-10268
7RUY 1.27 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8388
7RV2 1.29 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8828
1R29 1.3 Å, Crystal Structure of the B-Cell Lymphoma 6 (BCL6) BTB Domain to 1.3 Angstrom
7LWG 1.3 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-12694
7RUW 1.3 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-7859
7RUX 1.3 Å, Crystal structure of the BCL6 BTB domain in complex with OICR-8311

Browse structure collections

About this viewer

MolViewer shows 8AS9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.