KRAS-G12D in complex with BI-2865. Determined by X-ray diffraction at 1.09 Å resolution. Released 7 Jun 2023.
Explore 8AZY in 3D Show helices and sheets RCSB PDB PDBe
8AZY contains 6 α-helices and 6 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 3-9 | 7 | 1 |
| α-helix | 16-25 | 10 | |
| β-strand | 38-46 | 9 | 1 |
| β-strand | 49-57 | 9 | 1 |
| α-helix | 66-73 | 8 | |
| β-strand | 77-83 | 7 | 1 |
| α-helix | 87-91 | 5 | |
| α-helix | 93-104 | 12 | |
| β-strand | 111-116 | 6 | 1 |
| α-helix | 127-137 | 11 | |
| β-strand | 141-143 | 3 | 1 |
| α-helix | 152-168 | 17 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| GTPase KRas | A | protein | 170 | Homo sapiens | P01116 (AlphaFold model) |
>8AZY_1 GTPase KRas (chains A) GMTEYKLVVVGADGVGKSALTIQLIQNHFVDEYDPTIEDSYRKQVVIDGETCLLDILDTA GQEEYSAMRDQYMRTGEGFLCVFAINNTKSFEDIHHYREQIKRVKDSEDVPMVLVGNKSD LPSRTVDTKQAQDLARSYGIPFIETSAKTRQGVDDAFYTLVREIRKHKEK
| ID | Name | Formula | Copies |
|---|---|---|---|
| OFU | (4S)-2-azanyl-4-methyl-4-[3-[4-[(1S)-1-[(2S)-1-methylpyrrolidin-1-ium-2-yl]etho… | C23 H28 N7 O2 S | 1 |
| MG | Magnesium ion | Mg | 1 |
| GDP | Guanosine-5'-diphosphate | C10 H15 N5 O11 P2 | 1 |
Water and common crystallization additives (EDO) are not listed.
Pan-KRAS inhibitor disables oncogenic signalling and tumour growth. Kim, D., Herdeis, L., Rudolph, D. et al. Nature (2023) 619:160-166. DOI 10.1038/s41586-023-06123-3 · PubMed
Other PDB entries of the same protein (UniProt P01116 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8AZY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.