8B0F: C5b8-CD59

CryoEM structure of C5b8-CD59. Determined by electron microscopy at 3.0 Å resolution. Released 22 Feb 2023.

Method: Electron microscopy
Resolution: 3.0 Å
Organisms: Homo sapiens, Escherichia coli
Chains: 7
Atoms: 30,936
Mol. weight: 556.62 kDa
Ligands: CA, NAG
Released: 22 Feb 2023

Explore 8B0F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8B0F contains 146 α-helices and 274 β-strands across 7 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 40 helices, 93 β-strands

Element	Residues	Length	Sheet
β-strand	22-28	7	1
β-strand	31-32	2	2
β-strand	36-44	9	1
β-strand	50-58	9	3
β-strand	65-73	9	3
β-strand	80-86	7	1
α-helix	89-91	3
β-strand	101-108	8	3
β-strand	112-118	7	3
β-strand	119-120	2	2
β-strand	125-130	6	4
β-strand	134-135	2	5
β-strand	140-141	2	6
β-strand	143-148	6	4
β-strand	154	1	4
β-strand	159-164	6	5
β-strand	170-176	7	5
β-strand	182-184	3	4
α-helix	185-187	3
β-strand	188-189	2	6
α-helix	194-196	3
β-strand	197-205	9	5
β-strand	212-219	8	5
β-strand	227-233	7	7
β-strand	237-238	2	8
α-helix	240-243	4
β-strand	246-254	9	7
β-strand	259	1	7
β-strand	264-272	9	8
β-strand	282	1	8
β-strand	288-291	4	8
α-helix	293-295	3
β-strand	296-301	6	7
α-helix	303	1
α-helix	304-308	5
β-strand	322-330	9	8
β-strand	337-347	11	8
β-strand	352-356	5	9
β-strand	362-363	2	10
β-strand	369-377	9	9
β-strand	382	1	9
β-strand	387-396	10	10
α-helix	397-399	3
β-strand	400-410	11	10
α-helix	411-412	2
β-strand	417-422	6	9
β-strand	428-437	10	10
β-strand	449-456	8	10
β-strand	466-468	3	11
α-helix	475	1
β-strand	476	1	12
β-strand	481	1	13
α-helix	482	1
β-strand	484	1	14
β-strand	485-487	3	11
β-strand	498-505	8	15
β-strand	508-516	9	15
β-strand	517	1	16
β-strand	523	1	16
β-strand	526	1	14
α-helix	528	1
β-strand	529	1	13
α-helix	530-531	2
α-helix	532-534	3
β-strand	537-546	10	15
β-strand	553-562	10	15
β-strand	563	1	12
β-strand	572-575	4	17
β-strand	582	1	18
β-strand	587-606	20	17
α-helix	607-611	5
α-helix	623-627	5
α-helix	628-630	3
β-strand	637	1	15
α-helix	642-648	7
β-strand	651-655	5	1
α-helix	668-669	2
β-strand	772-789	18	17
α-helix	790-791	2
β-strand	796-805	10	17
β-strand	808-811	4	17
β-strand	815-818	4	17
β-strand	819	1	18
β-strand	823-827	5	19
β-strand	833-834	2	20
β-strand	839-847	9	19
β-strand	853-854	2	21
β-strand	855-861	7	20
β-strand	865-867	3	19
β-strand	887-888	2	21
β-strand	892-902	11	19
β-strand	906-916	11	20
β-strand	922-930	9	20
β-strand	934-944	11	22
β-strand	956-959	4	23
β-strand	967	1	22
β-strand	974-981	8	22
β-strand	992	1	24
α-helix	994-996	3
α-helix	997-1000	4
α-helix	1002	1
α-helix	1004	1
α-helix	1010-1026	17
α-helix	1029-1031	3
α-helix	1042-1058	17
β-strand	1060	1	25
β-strand	1066	1	25
β-strand	1067	1	26
α-helix	1073	1
β-strand	1074	1	26
α-helix	1076-1090	15
α-helix	1097-1111	15
α-helix	1119-1121	3
α-helix	1140-1155	16
α-helix	1156-1158	3
α-helix	1162-1179	18
α-helix	1185-1197	13
α-helix	1203-1215	13
β-strand	1217-1219	3	27
β-strand	1225-1227	3	27
α-helix	1242-1261	20
α-helix	1264-1274	11
α-helix	1277-1280	4
β-strand	1284	1	28
α-helix	1287-1307	21
β-strand	1310-1317	8	23
β-strand	1322-1329	8	23
β-strand	1332	1	23
β-strand	1334	1	22
β-strand	1338-1339	2	22
β-strand	1346-1350	5	23
β-strand	1354	1	23
β-strand	1357-1367	11	22

Chain B: 34 helices, 54 β-strands

Element	Residues	Length	Sheet
α-helix	24-26	3
α-helix	28	1
β-strand	29	1	29
α-helix	30-35	6
β-strand	42-47	6	30
β-strand	48	1	29
α-helix	54-58	5
β-strand	68-73	6	30
α-helix	77-79	3
β-strand	80	1	31
β-strand	83-84	2	32
α-helix	85-87	3
α-helix	89-94	6
β-strand	99-103	5	33
β-strand	106-108	3	32
β-strand	110	1	34
β-strand	111	1	31
α-helix	114-116	3
β-strand	122-126	5	33
β-strand	144-145	2	35
β-strand	151-152	2	35
α-helix	154-156	3
α-helix	184	1
β-strand	185-186	2	36
α-helix	187	1
α-helix	190-194	5
β-strand	195-198	4	37
β-strand	203-207	5	37
β-strand	209	1	38
β-strand	220-221	2	36
α-helix	228-229	2
β-strand	230-231	2	36
α-helix	232-233	2
β-strand	236-240	5	37
β-strand	244-273	30	37
β-strand	276-279	4	37
β-strand	286-327	42	37
β-strand	334	1	38
α-helix	336-343	8
α-helix	351-361	11
β-strand	364-407	44	37
β-strand	413-445	33	37
α-helix	449-457	9
α-helix	466-478	13
β-strand	481-489	9	37
α-helix	490-493	4
α-helix	500-518	19
α-helix	520-522	3
α-helix	524-526	3
α-helix	530	1
β-strand	531-535	5	34
β-strand	538-542	5	34
α-helix	543-544	2
β-strand	547-548	2	39
β-strand	554-555	2	39
α-helix	563	1
β-strand	564	1	40
α-helix	565	1
α-helix	567-570	4
α-helix	572-577	6
β-strand	582-586	5	41
α-helix	593-594	2
β-strand	595	1	40
α-helix	598-601	4
β-strand	606-610	5	41
β-strand	613	1	28
β-strand	616	1	24
β-strand	630	1	27
α-helix	635-637	3
α-helix	643	1
β-strand	644-645	2	42
α-helix	646-650	5
β-strand	653-655	3	43
β-strand	661-662	2	42
α-helix	666	1
β-strand	667-669	3	44
β-strand	670-672	3	43
β-strand	676-680	5	45
β-strand	683-685	3	44
β-strand	697-701	5	45
β-strand	703-705	3	46
β-strand	721-723	3	46
β-strand	724	1	47
β-strand	726	1	47
β-strand	727-729	3	48
β-strand	743-745	3	48
β-strand	746	1	49
β-strand	751	1	49

Chain C: 28 helices, 47 β-strands

Element	Residues	Length	Sheet
β-strand	26	1	50
β-strand	29-33	5	51
α-helix	34-36	3
α-helix	38-40	3
β-strand	45-49	5	52
β-strand	50-54	5	51
β-strand	56-57	2	50
α-helix	60-63	4
β-strand	68-72	5	52
α-helix	80-82	3
β-strand	89-90	2	53
β-strand	96-97	2	53
α-helix	99-101	3
α-helix	114-116	3
α-helix	137-141	5
β-strand	142-144	3	37
β-strand	151-154	4	37
β-strand	156	1	54
β-strand	167-170	4	55
β-strand	175-178	4	55
β-strand	185-187	3	37
β-strand	191-222	32	37
β-strand	225-263	39	37
α-helix	264-266	3
α-helix	270-271	2
β-strand	272	1	54
α-helix	273	1
α-helix	274-282	9
α-helix	289-299	11
β-strand	302-342	41	37
β-strand	348-378	31	37
α-helix	382-389	8
α-helix	400-409	10
β-strand	415-423	9	37
α-helix	424-427	4
α-helix	434-451	18
α-helix	454-456	3
α-helix	458-460	3
β-strand	465-469	5	50
β-strand	472-476	5	50
α-helix	477-478	2
β-strand	481-482	2	56
β-strand	488-489	2	56
β-strand	499	1	57
α-helix	503-510	8
α-helix	513-515	3
β-strand	516-520	5	58
α-helix	527-528	2
β-strand	529	1	57
α-helix	532-534	3
β-strand	540-544	5	58
α-helix	548-556	9
α-helix	558-560	3
β-strand	570	1	59
α-helix	574-576	3
β-strand	577	1	60
β-strand	580-582	3	60
β-strand	590	1	59
β-strand	594-596	3	61
β-strand	597-599	3	60
α-helix	600	1
β-strand	603-607	5	62
β-strand	610-613	4	61
β-strand	619-621	3	61
β-strand	624-628	5	62
β-strand	631	1	63
α-helix	632-634	3
β-strand	641-642	2	64
β-strand	649	1	63
β-strand	654-656	3	65
β-strand	657-658	2	64
β-strand	666	1	66
β-strand	670-675	6	65
β-strand	678-680	3	65
β-strand	687	1	66

Chain D: 17 helices, 32 β-strands

Element	Residues	Length	Sheet
β-strand	9	1	67
β-strand	12-13	2	68
α-helix	14-18	5
α-helix	20-23	4
β-strand	28-32	5	69
β-strand	35-37	3	68
β-strand	39	1	70
β-strand	40	1	67
β-strand	51-55	5	69
β-strand	71-72	2	71
β-strand	79-80	2	71
α-helix	82-84	3
β-strand	113	1	72
α-helix	114-115	2
α-helix	118-122	5
β-strand	123-126	4	37
β-strand	131-135	5	37
β-strand	137	1	73
β-strand	148-151	4	72
β-strand	154-157	4	72
β-strand	162-166	5	37
β-strand	170-199	30	37
β-strand	217-252	36	37
β-strand	259	1	73
α-helix	261-269	9
α-helix	276-286	11
β-strand	289-326	38	37
β-strand	347-360	14	37
β-strand	363-374	12	37
α-helix	378-384	7
α-helix	389-391	3
α-helix	392-404	13
β-strand	407-415	9	37
α-helix	416-419	4
α-helix	428-446	19
α-helix	448-450	3
α-helix	452-454	3
β-strand	459-462	4	74
β-strand	466	1	70
β-strand	467-470	4	74
β-strand	476	1	75
β-strand	482	1	75
α-helix	491-492	2
β-strand	493	1	76
α-helix	494-502	9
β-strand	506-509	4	77
β-strand	515	1	76
α-helix	525-526	2
β-strand	531-534	4	77

Chain E: 18 helices, 31 β-strands

Element	Residues	Length	Sheet
α-helix	7-9	3
β-strand	10-11	2	78
α-helix	12-19	8
β-strand	26-30	5	79
β-strand	33-35	3	78
β-strand	37	1	80
β-strand	49-53	5	79
α-helix	59-60	2
β-strand	70-71	2	81
α-helix	72	1
β-strand	78-79	2	81
α-helix	81-83	3
α-helix	114	1
β-strand	115	1	82
α-helix	119-123	5
β-strand	124-127	4	37
β-strand	132-136	5	37
β-strand	138	1	83
β-strand	149-151	3	82
β-strand	157-161	5	84
β-strand	166-170	5	84
β-strand	175-177	3	82
α-helix	178-179	2
β-strand	182-185	4	37
β-strand	190-217	28	37
β-strand	240-273	34	37
β-strand	278	1	85
β-strand	280	1	83
α-helix	282-289	8
α-helix	297-306	10
β-strand	310-345	36	37
β-strand	369-394	26	37
α-helix	398-406	9
α-helix	410-422	13
β-strand	425-433	9	37
α-helix	434-437	4
β-strand	441	1	85
α-helix	447-463	17
α-helix	466-469	4
β-strand	477-480	4	86
β-strand	484	1	80
β-strand	485-488	4	86
β-strand	508	1	87
α-helix	512-519	8
β-strand	525-529	5	88
α-helix	536-537	2
β-strand	538	1	87
α-helix	541-544	4
β-strand	549-553	5	88

Chain F: 7 helices, 11 β-strands

Element	Residues	Length	Sheet
α-helix	18-19	2
α-helix	24-27	4
β-strand	31-38	8	89
α-helix	41-44	4
β-strand	54-60	7	89
β-strand	63-72	10	89
β-strand	75-83	9	89
β-strand	85-88	4	89
β-strand	91-92	2	89
β-strand	104-111	8	89
β-strand	115-122	8	89
β-strand	125-132	8	89
α-helix	137-138	2
α-helix	139-151	13
α-helix	156-158	3
β-strand	159-161	3	89
α-helix	162-163	2
β-strand	176	1	89

Chain G: 2 helices, 6 β-strands

Element	Residues	Length	Sheet
β-strand	4	1	90
β-strand	6	1	37
β-strand	16	1	90
β-strand	27-31	5	37
β-strand	34-38	5	37
α-helix	47-54	8
β-strand	60-62	3	37
α-helix	72-74	3

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Complement C5	A	protein	1676	Homo sapiens	P01031 (AlphaFold model)
Complement component C6	B	protein	934	Homo sapiens	P13671 (AlphaFold model)
Complement component C7	C	protein	843	Homo sapiens	P10643 (AlphaFold model)
Complement component C8 beta chain	D	protein	591	Homo sapiens	P07358 (AlphaFold model)
Complement component C8 alpha chain	E	protein	584	Homo sapiens	P07357
Complement component C8 gamma chain	F	protein	202	Homo sapiens	P07360
CD59 glycoprotein	G	protein	120	Escherichia coli	P13987

Sequence of entity 1 (A), FASTA

>8B0F_1 Complement C5 (chains A)
MGLLGILCFLIFLGKTWGQEQTYVISAPKIFRVGASENIVIQVYGYTEAFDATISIKSYP
DKKFSYSSGHVHLSSENKFQNSAILTIQPKQLPGGQNPVSYVYLEVVSKHFSKSKRMPIT
YDNGFLFIHTDKPVYTPDQSVKVRVYSLNDDLKPAKRETVLTFIDPEGSEVDMVEEIDHI
GIISFPDFKIPSNPRYGMWTIKAKYKEDFSTTGTAYFEVKEYVLPHFSVSIEPEYNFIGY
KNFKNFEITIKARYFYNKVVTEADVYITFGIREDLKDDQKEMMQTAMQNTMLINGIAQVT
FDSETAVKELSYYSLEDLNNKYLYIAVTVIESTGGFSEEAEIPGIKYVLSPYKLNLVATP
LFLKPGIPYPIKVQVKDSLDQLVGGVPVTLNAQTIDVNQETSDLDPSKSVTRVDDGVASF
VLNLPSGVTVLEFNVKTDAPDLPEENQAREGYRAIAYSSLSQSYLYIDWTDNHKALLVGE
HLNIIVTPKSPYIDKITHYNYLILSKGKIIHFGTREKFSDASYQSINIPVTQNMVPSSRL
LVYYIVTGEQTAELVSDSVWLNIEEKCGNQLQVHLSPDADAYSPGQTVSLNMATGMDSWV
ALAAVDSAVYGVQRGAKKPLERVFQFLEKSDLGCGAGGGLNNANVFHLAGLTFLTNANAD
DSQENDEPCKEILRPRRTLQKKIEEIAAKYKHSVVKKCCYDGACVNNDETCEQRAARISL
GPRCIKAFTECCVVASQLRANISHKDMQLGRLHMKTLLPVSKPEIRSYFPESWLWEVHLV
PRRKQLQFALPDSLTTWEIQGVGISNTGICVADTVKAKVFKDVFLEMNIPYSVVRGEQIQ
LKGTVYNYRTSGMQFCVKMSAVEGICTSESPVIDHQGTKSSKCVRQKVEGSSSHLVTFTV
LPLEIGLHNINFSLETWFGKEILVKTLRVVPEGVKRESYSGVTLDPRGIYGTISRRKEFP
YRIPLDLVPKTEIKRILSVKGLLVGEILSAVLSQEGINILTHLPKGSAEAELMSVVPVFY
VFHYLETGNHWNIFHSDPLIEKQKLKKKLKEGMLSIMSYRNADYSYSVWKGGSASTWLTA
FALRVLGQVNKYVEQNQNSICNSLLWLVENYQLDNGSFKENSQYQPIKLQGTLPVEAREN
SLYLTAFTVIGIRKAFDICPLVKIDTALIKADNFLLENTLPAQSTFTLAISAYALSLGDK
THPQFRSIVSALKREALVKGNPPIYRFWKDNLQHKDSSVPNTGTARMVETTAYALLTSLN
LKDINYVNPVIKWLSEEQRYGGGFYSTQDTINAIEGLTEYSLLVKQLRLSMDIDVSYKHK
GALHNYKMTDKNFLGRPVEVLLNDDLIVSTGFGSGLATVHVTTVVHKTSTSEEVCSFYLK
IDTQDIEASHYRGYGNSDYKRIVACASYKPSREESSSGSSHAVMDISLPTGISANEEDLK
ALVEGVDQLFTDYQIKDGHVILQLNSIPSSDFLCVRFRIFELFEVGFLSPATFTVYEYHR
PDKQCTMFYSTSNIKIQKVCEGAACKCVEADCGQMQEELDLTISAETRKQTACKPEIAYA
YKVSITSITVENVFVKYKATLLDIYKTGEAVAEKDSEITFIKKVTCTNAELVKGRQYLIM
GKEALQIKYNFSFRYIYPLDSLTWIEYWPRDTTCSSCQAFLANLDEFAEDIFLNGC

Sequence of entity 2 (B), FASTA

>8B0F_2 Complement component C6 (chains B)
MARRSVLYFILLNALINKGQACFCDHYAWTQWTSCSKTCNSGTQSRHRQIVVDKYYQENF
CEQICSKQETRECNWQRCPINCLLGDFGPWSDCDPCIEKQSKVRSVLRPSQFGGQPCTAP
LVAFQPCIPSKLCKIEEADCKNKFRCDSGRCIARKLECNGENDCGDNSDERDCGRTKAVC
TRKYNPIPSVQLMGNGFHFLAGEPRGEVLDNSFTGGICKTVKSSRTSNPYRVPANLENVG
FEVQTAEDDLKTDFYKDLTSLGHNENQQGSFSSQGGSSFSVPIFYSSKRSENINHNSAFK
QAIQASHKKDSSFIRIHKVMKVLNFTTKAKDLHLSDVFLKALNHLPLEYNSALYSRIFDD
FGTHYFTSGSLGGVYDLLYQFSSEELKNSGLTEEEAKHCVRIETKKRVLFAKKTKVEHRC
TTNKLSEKHEGSFIQGAEKSISLIRGGRSEYGAALAWEKGSSGLEEKTFSEWLESVKENP
AVIDFELAPIVDLVRNIPCAVTKRNNLRKALQEYAAKFDPCQCAPCPNNGRPTLSGTECL
CVCQSGTYGENCEKQSPDYKSNAVDGQWGCWSSWSTCDATYKRSRTRECNNPAPQRGGKR
CEGEKRQEEDCTFSIMENNGQPCINDDEEMKEVDLPEIEADSGCPQPVPPENGFIRNEKQ
LYLVGEDVEISCLTGFETVGYQYFRCLPDGTWRQGDVECQRTECIKPVVQEVLTITPFQR
LYRIGESIELTCPKGFVVAGPSRYTCQGNSWTPPISNSLTCEKDTLTKLKGHCQLGQKQS
GSECICMSPEEDCSHHSEDLCVFDTDSNDYFTSPACKFLAEKCLNNQQLHFLHIGSCQDG
RQLEWGLERTRLSSNSTKKESCGYDTCYDWEKCSASTSKCVCLLPPQCFKGGNQLYCVKM
GSSTSEKTLNICEVGTIRCANRKMEILHPGKCLA

Sequence of entity 3 (C), FASTA

>8B0F_3 Complement component C7 (chains C)
MKVISLFILVGFIGEFQSFSSASSPVNCQWDFYAPWSECNGCTKTQTRRRSVAVYGQYGG
QPCVGNAFETQSCEPTRGCPTEEGCGERFRCFSGQCISKSLVCNGDSDCDEDSADEDRCE
DSERRPSCDIDKPPPNIELTGNGYNELTGQFRNRVINTKSFGGQCRKVFSGDGKDFYRLS
GNVLSYTFQVKINNDFNYEFYNSTWSYVKHTSTEHTSSSRKRSFFRSSSSSSRSYTSHTN
EIHKGKSYQLLVVENTVEVAQFINNNPEFLQLAEPFWKELSHLPSLYDYSAYRRLIDQYG
THYLQSGSLGGEYRVLFYVDSEKLKQNDFNSVEEKKCKSSGWHFVVKFSSHGCKELENAL
KAASGTQNNVLRGEPFIRGGGAGFISGLSYLELDNPAGNKRRYSAWAESVTNLPQVIKQK
LTPLYELVKEVPCASVKKLYLKWALEEYLDEFDPCHCRPCQNGGLATVEGTHCLCHCKPY
TFGAACEQGVLVGNQAGGVDGGWSCWSSWSPCVQGKKTRSRECNNPPPSGGGRSCVGETT
ESTQCEDEELEHLRLLEPHCFPLSLVPTEFCPSPPALKDGFVQDEGTMFPVGKNVVYTCN
EGYSLIGNPVARCGEDLRWLVGEMHCQKIACVLPVLMDGIQSHPQKPFYTVGEKVTVSCS
GGMSLEGPSAFLCGSSLKWSPEMKNARCVQKENPLTQAVPKCQRWEKLQNSRCVCKMPYE
CGPSLDVCAQDERSKRILPLTVCKMHVLHCQGRNYTLTGRDSCTLPASAEKACGACPLWG
KCDAESSKCVCREASECEEEGFSICVEVNGKEQTMSECEAGALRCRGQSISVTSIRPCAA
ETQ

Sequence of entity 4 (D), FASTA

>8B0F_4 Complement component C8 beta chain (chains D)
MKNSRTWAWRAPVELFLLCAALGCLSLPGSRGERPHSFGSNAVNKSFAKSRQMRSVDVTL
MPIDCELSSWSSWTTCDPCQKKRYRYAYLLQPSQFHGEPCNFSDKEVEDCVTNRPCRSQV
RCEGFVCAQTGRCVNRRLLCNGDNDCGDQSDEANCRRIYKKCQHEMDQYWGIGSLASGIN
LFTNSFEGPVLDHRYYAGGCSPHYILNTRFRKPYNVESYTPQTQGKYEFILKEYESYSDF
ERNVTEKMASKSGFSFGFKIPGIFELGISSQSDRGKHYIRRTKRFSHTKSVFLHARSDLE
VAHYKLKPRSLMLHYEFLQRVKRLPLEYSYGEYRDLFRDFGTHYITEAVLGGIYEYTLVM
NKEAMERGDYTLNNVHACAKNDFKIGGAIEEVYVSLGVSVGKCRGILNEIKDRNKRDTMV
EDLVVLVRGGASEHITTLAYQELPTADLMQEWGDAVQYNPAIIKVKVEPLYELVTATDFA
YSSTVRQNMKQALEEFQKEVSSCHCAPCQGNGVPVLKGSRCDCICPVGSQGLACEVSYRK
NTPIDGKWNCWSNWSSCSGRRKTRQRQCNNPPPQNGGSPCSGPASETLDCS

Sequence of entity 5 (E), FASTA

>8B0F_5 Complement component C8 alpha chain (chains E)
MFAVVFFILSLMTCQPGVTAQEKVNQRVRRAATPAAVTCQLSNWSEWTDCFPCQDKKYRH
RSLLQPNKFGGTICSGDIWDQASCSSSTTCVRQAQCGQDFQCKETGRCLKRHLVCNGDQD
CLDGSDEDDCEDVRAIDEDCSQYEPIPGSQKAALGYNILTQEDAQSVYDASYYGGQCETV
YNGEWRELRYDSTCERLYYGDDEKYFRKPYNFLKYHFEALADTGISSEFYDNANDLLSKV
KKDKSDSFGVTIGIGPAGSPLLVGVGVSHSQDTSFLNELNKYNEKKFIFTRIFTKVQTAH
FKMRKDDIMLDEGMLQSLMELPDQYNYGMYAKFINDYGTHYITSGSMGGIYEYILVIDKA
KMESLGITSRDITTCFGGSLGIQYEDKINVGGGLSGDHCKKFGGGKTERARKAMAVEDII
SRVRGGSSGWSGGLAQNRSTITYRSWGRSLKYNPVVIDFEMQPIHEVLRHTSLGPLEAKR
QNLRRALDQYLMEFNACRCGPCFNNGVPILEGTSCRCQCRLGSLGAACEQTQTEGAKADG
SWSCWSSWSVCRAGIQERRRECDNPAPQNGGASCPGRKVQTQAC

Sequence of entity 6 (F), FASTA

>8B0F_6 Complement component C8 gamma chain (chains F)
MLPPGTATLLTLLLAAGSLGQKPQRPRRPASPISTIQPKANFDAQQFAGTWLLVAVGSAC
RFLQEQGHRAEATTLHVAPQGTAMAVSTFRKLDGICWQVRQLYGDTGVLGRFLLQARDAR
GAVHVVVAETDYQSFAVLYLERAGQLSVKLYARSLPVSDSVLSGFEQRVQEAHLTEDQIF
YFPKYGFCEAADQFHVLDEVRR

Sequence of entity 7 (G), FASTA

>8B0F_7 CD59 glycoprotein (chains G)
MGIQGGSVLFGLLLVLAVFCHSGHSLQCYNCPNPTADCKTAVNCSSDFDACLITKAGLQV
YNKCWKFEHCNFNDVTTRLRENELTYYCCKKDLCNFNEQLENGGTSLSEKTVLLLVTPFL

Ligands and cofactors

ID	Name	Formula	Copies
CA	Calcium ion	Ca	2
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	1

Primary citation

Structural basis for membrane attack complex inhibition by CD59. Couves, E.C., Gardner, S., Voisin, T.B. et al. Nat Commun (2023) 14:890-890. DOI 10.1038/s41467-023-36441-z · PubMed

Other PDB entries of the same protein (UniProt P01031 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9Y6C 2.0 Å, X-ray structure analysis of human Complement Component 5 TE domain in complex with the…
5B71 2.11 Å, Crystal structure of complement C5 in complex with SKY59
4UU9 2.12 Å, Crystal structure of the human c5a in complex with MEDI7814 a neutralising antibody
7AD7 2.3 Å, Crystal structure of human complement C5 in complex with the K8 bovine knob domain…
5B4P 2.4 Å, Complex structure of human C5a and its binding repebody
4P39 2.4 Å, Crystal structure of the human C5aR antagonist C5a-A8
7OP0 2.57 Å, Crystal structure of complement C5 in complex with chemically synthesized K92 knob domain.
3HQA 2.59 Å, Crystal structure of human desarg-C5A
5HCC 2.59 Å, Ternary complex of human Complement C5 with Ornithodoros moubata OmCI and Dermacentor…
22GM 2.7 Å, C5a bound C5aR1 in complex with beta-arrestin1
6RPT 2.7 Å, Structure of tick complement inhibitor CirpT1 complexed with macroglobubulin domain 4 of…
7AD6 2.75 Å, Crystal structure of human complement C5 in complex with the K92 bovine knob domain…

Browse structure collections

About this viewer

MolViewer shows 8B0F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.