Crystal structure of the SUN1-KASH6 9:6 complex. Determined by X-ray diffraction at 1.98 Å resolution. Released 4 Oct 2023.
Explore 8B5X in 3D Show helices and sheets RCSB PDB PDBe
8B5X contains 25 α-helices and 44 β-strands across 5 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 619-634 | 16 | |
| β-strand | 651-652 | 2 | 1 |
| α-helix | 654-656 | 3 | |
| α-helix | 658-659 | 2 | |
| β-strand | 660 | 1 | 2 |
| α-helix | 661 | 1 | |
| β-strand | 666-670 | 5 | 3 |
| β-strand | 673-677 | 5 | 3 |
| α-helix | 682-686 | 5 | |
| β-strand | 696-699 | 4 | 2 |
| β-strand | 703-721 | 19 | 1 |
| α-helix | 725-727 | 3 | |
| β-strand | 737 | 1 | 4 |
| β-strand | 739-745 | 7 | 1 |
| β-strand | 754-760 | 7 | 1 |
| β-strand | 768-772 | 5 | 1 |
| α-helix | 773-775 | 3 | |
| β-strand | 782-789 | 8 | 1 |
| β-strand | 792 | 1 | 4 |
| β-strand | 798-801 | 4 | 2 |
| β-strand | 803-810 | 8 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 619-634 | 16 | |
| β-strand | 651-652 | 2 | 5 |
| α-helix | 654-656 | 3 | |
| α-helix | 658-659 | 2 | |
| β-strand | 660 | 1 | 6 |
| α-helix | 661 | 1 | |
| β-strand | 668-670 | 3 | 7 |
| β-strand | 673-675 | 3 | 7 |
| α-helix | 682-686 | 5 | |
| β-strand | 696-699 | 4 | 6 |
| β-strand | 703-721 | 19 | 5 |
| α-helix | 725-727 | 3 | |
| β-strand | 737 | 1 | 8 |
| β-strand | 739-745 | 7 | 5 |
| β-strand | 754-760 | 7 | 5 |
| β-strand | 768-772 | 5 | 5 |
| α-helix | 773-774 | 2 | |
| β-strand | 782-789 | 8 | 5 |
| β-strand | 792 | 1 | 8 |
| β-strand | 798-801 | 4 | 6 |
| β-strand | 803-810 | 8 | 5 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 619-634 | 16 | |
| β-strand | 651-652 | 2 | 9 |
| α-helix | 654-656 | 3 | |
| α-helix | 659 | 1 | |
| β-strand | 660 | 1 | 10 |
| α-helix | 661 | 1 | |
| β-strand | 666-670 | 5 | 11 |
| β-strand | 673-678 | 6 | 11 |
| α-helix | 682-686 | 5 | |
| β-strand | 696-699 | 4 | 10 |
| β-strand | 703-721 | 19 | 9 |
| α-helix | 725-727 | 3 | |
| β-strand | 737 | 1 | 12 |
| β-strand | 739-745 | 7 | 9 |
| β-strand | 754-760 | 7 | 9 |
| β-strand | 768-772 | 5 | 9 |
| α-helix | 773-776 | 4 | |
| β-strand | 782-789 | 8 | 9 |
| β-strand | 792 | 1 | 12 |
| β-strand | 798-801 | 4 | 10 |
| β-strand | 803-810 | 8 | 9 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 531-541 | 11 | |
| α-helix | 542-544 | 3 | |
| β-strand | 546-549 | 4 | 3 |
| α-helix | 552-554 | 3 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 545-546 | 2 | 7 |
| α-helix | 552-554 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| SUN domain-containing protein 1 | A, B, C | protein | 203 | Homo sapiens | O94901 (AlphaFold model) |
| Inositol 1,4,5-triphosphate receptor associated 2 | D, E | protein | 44 | Homo sapiens | Q12912 (AlphaFold model) |
>8B5X_1 SUN domain-containing protein 1 (chains A, B, C) GSGGSGGITEAQARAIVNSALKLYSQDKTGMVDFALESGGGSILSTRCSETYETKTALMS LFGIPLWYFSQSPRVVIQPDIYPGNCWAFKGSQGYLVVRLSMMIHPAAFTLEHIPKTLSP TGNISSAPKDFAVYGLENEYQEEGQLLGQFTYDQDGESLQMFQALKRPDDTAFQIVELRI FSNWGHPEYTCLYRFRVHGEPVK
>8B5X_2 Inositol 1,4,5-triphosphate receptor associated 2 (chains D, E) GSMTGQLFQKSVDAAPTQQEDSWTSLEHILWPFTRLRHNGPPPV
The crystal structure of SUN1-KASH6 reveals an asymmetric LINC complex architecture compatible with nuclear membrane insertion. Gurusaran, M., Erlandsen, B.S., Davies, O.R. Commun Biol (2024) 7:138-138. DOI 10.1038/s42003-024-05794-6 · PubMed
Other PDB entries of the same protein (UniProt O94901 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8B5X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.