8BF1: Unliganded PPAR gamma

High-resolution structure of unliganded PPAR gamma in complex with the peptide PGC-1 alpha. Determined by X-ray diffraction at 1.36 Å resolution. Released 8 Mar 2023.

Method: X-ray diffraction
Resolution: 1.36 Å
Organism: Homo sapiens
Chains: 2
Atoms: 2,469
Mol. weight: 34.48 kDa
Released: 8 Mar 2023

Explore 8BF1 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8BF1 contains 13 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 12 helices, 4 β-strands

Element	Residues	Length	Sheet
α-helix	207-225	19
α-helix	230-237	8
α-helix	244-246	3
β-strand	247-249	3	1
α-helix	252-262	11
α-helix	277-301	25
α-helix	311-332	22
β-strand	334-335	2	1
β-strand	338-341	4	1
β-strand	346-349	4	1
α-helix	350-354	5
α-helix	365-375	11
α-helix	381-392	12
α-helix	403-424	22
α-helix	431-459	29
α-helix	467-473	7

Chain B: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	143-149	7

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Peroxisome proliferator-activated receptor gamma	A	protein	283	Homo sapiens	P37231 (AlphaFold model)
Peroxisome proliferator-activated receptor gamma coactivator 1-alpha	B	protein	19	Homo sapiens	Q9UBK2 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8BF1_1 Peroxisome proliferator-activated receptor gamma (chains A)
MRGSHHHHHHGPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNS
LMMGEDKIKFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQ
VTLLKYGVHEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKF
NALELDDSDLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAK
LLQKMTDLRQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY

Sequence of entity 2 (B), FASTA

>8BF1_2 Peroxisome proliferator-activated receptor gamma coactivator 1-alpha (chains B)
QEAEEPSLLKKLLLAPANT

Primary citation

Structural basis of the activation of PPAR gamma by the plasticizer metabolites MEHP and MINCH. Useini, A., Engelberger, F., Kunze, G. et al. Environ Int (2023) 173:107822-107822. DOI 10.1016/j.envint.2023.107822 · PubMed

Other PDB entries of the same protein (UniProt P37231 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9F7W 1.25 Å, Human PPARgamma ligand binding domain in complex with co-activator 1alpha peptide and…
9V8G 1.39 Å, PPARgamma ligand-binding domain in complex with PG08-NL
9V8H 1.39 Å, PPARgamma ligand-binding domain in complex with PG08-NL and rosiglitazone
8FKC 1.42 Å, Crystal structure of PPARgamma ligand-binding domain in complex with N-CoR peptide and…
6MS7 1.43 Å, Peroxisome proliferator-activated receptor gamma ligand binding domain in complex with a…
9V8D 1.44 Å, PPARgamma ligand-binding domain in complex with PG08
3U9Q 1.52 Å, Ligand binding domain of PPARgamma complexed with Decanoic Acid and PGC-1a peptide
8B94 1.55 Å, Crystal structure of PPARG and NCOR2 with BAY-5516, an inverse agonist
8DKV 1.59 Å, PPARg bound to JTP-426467 and Co-R peptide
3B1M 1.6 Å, Crystal structure of the PPARgamma-LBD complexed with a cercosporamide derivative…
3V9V 1.6 Å, Crystal structure of the PPARgamma-LBD complexed with a cercosporamide derivative…
9F7X 1.63 Å, Human PPARgamma ligand binding domain in complex with co-activator 1alpha peptide and…

Browse structure collections

About this viewer

MolViewer shows 8BF1 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.