PPARgamma ligand-binding domain in complex with PG08. Determined by X-ray diffraction at 1.44 Å resolution. Released 5 Nov 2025.
Explore 9V8D in 3D Show helices and sheets RCSB PDB PDBe
9V8D contains 17 α-helices and 4 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 208-225 | 18 | |
| α-helix | 230-237 | 8 | |
| α-helix | 246 | 1 | |
| β-strand | 247-249 | 3 | 1 |
| α-helix | 252-258 | 7 | |
| α-helix | 277-300 | 24 | |
| α-helix | 306-308 | 3 | |
| α-helix | 311-332 | 22 | |
| β-strand | 334-335 | 2 | 1 |
| β-strand | 338-341 | 4 | 1 |
| β-strand | 346-349 | 4 | 1 |
| α-helix | 350-354 | 5 | |
| α-helix | 357 | 1 | |
| α-helix | 360-362 | 3 | |
| α-helix | 365-375 | 11 | |
| α-helix | 381-392 | 12 | |
| α-helix | 403-424 | 22 | |
| α-helix | 431-459 | 29 | |
| α-helix | 467-473 | 7 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-10 | 5 | |
| α-helix | 12-19 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peroxisome proliferator-activated receptor gamma | A | protein | 275 | Homo sapiens | P37231 (AlphaFold model) |
| PG08 | B | protein | 25 | synthetic construct |
>9V8D_1 Peroxisome proliferator-activated receptor gamma (chains A) QLNPESADLRALAKHLYDSYIKSFPLTKAKARAILTGKTTDKSPFVIYDMNSLMMGEDKI KFKHITPLQEQSKEVAIRIFQGCQFRSVEAVQEITEYAKSIPGFVNLDLNDQVTLLKYGV HEIIYTMLASLMNKDGVLISEGQGFMTREFLKSLRKPFGDFMEPKFEFAVKFNALELDDS DLAIFIAVIILSGDRPGLLNVKPIEDIQDNLLQALELQLKLNHPESSQLFAKLLQKMTDL RQIVTEHVQLLQVIKKTETDMSLHPLLQEIYKDLY
>9V8D_2 PG08 (chains B) YKTANSVXVRHXLLTAILXGVSGSN
De Novo Discovery of alpha , alpha-Disubstituted alpha-amino Acid-Containing alpha-helical Peptides as Competitive PPAR gamma PPI Inhibitors. Sigal, M., Egner, M., Okada, C. et al. J Am Chem Soc (2025) 147:42607-42617. DOI 10.1021/jacs.5c13803 · PubMed
Other PDB entries of the same protein (UniProt P37231 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9V8D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.