Murine amyloid-beta filaments with the Arctic mutation (E22G) from APP(NL-G-F) mouse brains | ABeta. Determined by electron microscopy at 3.5 Å resolution. Released 18 Jan 2023.
Explore 8BG9 in 3D Show helices and sheets RCSB PDB PDBe
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Amyloid-beta protein 40 | A, B | protein | 37 | Mus musculus | P12023 (AlphaFold model) |
>8BG9_1 Amyloid-beta protein 40 (chains A, B) DAEFRHDSGYEVHHQKLVFFAGDVGSNKGAIIGLMVG
Cryo-EM structures of amyloid-beta filaments with the Arctic mutation (E22G) from human and mouse brains. Yang, Y., Zhang, W., Murzin, A.G. et al. Acta Neuropathol (2023) 145:325-333. DOI 10.1007/s00401-022-02533-1 · PubMed
Other PDB entries of the same protein (UniProt P12023 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8BG9 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.