Crystal Structure of Ephrin A2 (EphA2) Receptor Protein Kinase with Compound 14. Determined by X-ray diffraction at 1.12 Å resolution. Released 8 Mar 2023.
Explore 8BOM in 3D Show helices and sheets RCSB PDB PDBe
8BOM contains 18 α-helices and 12 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 607 | 1 | 1 |
| α-helix | 610-612 | 3 | |
| β-strand | 613-621 | 9 | 1 |
| β-strand | 626-632 | 7 | 1 |
| β-strand | 641-648 | 8 | 1 |
| α-helix | 654-669 | 16 | |
| β-strand | 675 | 1 | 2 |
| α-helix | 676-677 | 2 | |
| β-strand | 678-682 | 5 | 1 |
| β-strand | 688-693 | 6 | 1 |
| β-strand | 699 | 1 | 2 |
| α-helix | 700-705 | 6 | |
| α-helix | 713-732 | 20 | |
| α-helix | 742-744 | 3 | |
| β-strand | 745-747 | 3 | 2 |
| β-strand | 753-755 | 3 | 2 |
| α-helix | 781-783 | 3 | |
| α-helix | 786-791 | 6 | |
| α-helix | 796-811 | 16 | |
| α-helix | 815-816 | 2 | |
| α-helix | 823-832 | 10 | |
| α-helix | 836-839 | 4 | |
| β-strand | 843 | 1 | 3 |
| α-helix | 844-853 | 10 | |
| α-helix | 858-860 | 3 | |
| α-helix | 862-863 | 2 | |
| α-helix | 864-876 | 13 | |
| α-helix | 878-881 | 4 | |
| β-strand | 884 | 1 | 3 |
| α-helix | 885-887 | 3 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Ephrin type-A receptor 2 | A | protein | 306 | Homo sapiens | P29317 (AlphaFold model) |
>8BOM_1 Ephrin type-A receptor 2 (chains A) GDPNQAVLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTE KQRVDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVL QLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTT SGGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKAINDGF RLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIRAPDSLKTLADFDPRVSIR LPSTSG
| ID | Name | Formula | Copies |
|---|---|---|---|
| QU6 | ~{N}-(3-methoxyphenyl)-4-methyl-3-[(1-methyl-6-pyridin-3-yl-pyrazolo[3,4-d]pyri… | C26 H23 N7 O2 | 1 |
Optimization of the Lead Compound NVP-BHG712 as a Colorectal Cancer Inhibitor. Troster, A., DiPrima, M., Jores, N. et al. Chemistry (2023) 29:e202203967-e202203967. DOI 10.1002/chem.202203967 · PubMed
Other PDB entries of the same protein (UniProt P29317 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8BOM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.