8C03: SLC40/ferroportin

Structure of SLC40/ferroportin in complex with vamifeport and synthetic nanobody Sy12 in outward-facing conformation. Determined by electron microscopy at 3.89 Å resolution. Released 22 Mar 2023.

Method: Electron microscopy
Resolution: 3.89 Å
Organism: Homo sapiens
Chains: 1
Atoms: 3,330
Mol. weight: 63.95 kDa
Ligands: SZU
Released: 22 Mar 2023

Explore 8C03 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8C03 contains 19 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 19 helices, 0 β-strands

Element	Residues	Length
α-helix	24-53	30
α-helix	58-85	28
α-helix	88-115	28
α-helix	117-120	4
α-helix	126-151	26
α-helix	152-158	7
α-helix	159-163	5
α-helix	167-198	32
α-helix	201-229	29
α-helix	231-233	3
α-helix	289-304	16
α-helix	308-318	11
α-helix	326-335	10
α-helix	339-366	28
α-helix	370-392	23
α-helix	452-482	31
α-helix	486-488	3
α-helix	489-513	25
α-helix	520-545	26

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Solute carrier family 40 member 1	A	protein	580	Homo sapiens	Q9NP59 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8C03_1 Solute carrier family 40 member 1 (chains A)
MSTRAGDHNRQRGCCGSLADYLTSAKFLLYLGHSLSTWGDRMWHFAVSVFLVELYGNSLL
LTAVYGLVVAGSVLVLGAIIGDWVDKNARLKVAQTSLVVQNVSVILCGIILMMVFLHKHE
LLTMYHGWVLTSCYILIITIANIANLASTATAITIQRDWIVVVAGEDRSKLANMNATIRR
IDQLTNILAPMAVGQIMTFGSPVIGCGFISGWNLVSMCVEYVLLWKVYQKTPALAVKAGL
KEEETELKQLNLHKDTEPKPLEGTHLMGVKDSNIHELEHEQEPTCASQMAEPFRTFRDGW
VSYYNQPVFLAGMGLAFLYMTVLGFDCITTGYAYTQGLSGSILSILMGASAITGIMGTVA
FTWLRRKCGLVRTGLISGLAQLSCLILCVISVFMPGSPLDLSVSPFEDIRSRFIQGESIT
PTKIPEITTEIYMSNGSNSANIVPETSPESVPIISVSLLFAGVIAARIGLWSFDLTVTQL
LQENVIESERGIINGVQNSMNYLLDLLHFIMVILAPNPEAFGLLVLISVSFVAMGHIMYF
RFAQNTLGNKLFACGPDAKEVRKENQANTSVVALEVLFQG

Ligands and cofactors

ID	Name	Formula	Copies
SZU	2-[2-[2-(1~{H}-benzimidazol-2-yl)ethylamino]ethyl]-~{N}-[(3-fluoranylpyridin-2-…	C21 H21 F N6 O2	1

Primary citation

Structures of ferroportin in complex with its specific inhibitor vamifeport. Lehmann, E.F., Liziczai, M., Drozdzyk, K. et al. Elife (2023) 12. DOI 10.7554/eLife.83053 · PubMed

Other PDB entries of the same protein (UniProt Q9NP59 (AlphaFold model), which also has an AlphaFold model), best resolution first:

6WBV 2.5 Å, Structure of human ferroportin bound to hepcidin and cobalt in lipid nanodisc
8DL7 2.7 Å, Cryo-EM structure of human ferroportin/slc40 bound to minihepcidin PR73 in nanodisc
8DL6 3.0 Å, Cryo-EM structure of human ferroportin/slc40 bound to Ca2+ in nanodisc
8DL8 3.0 Å, Cryo-EM structure of human ferroportin/slc40 bound to Co2+ in nanodisc
6W4S 3.2 Å, Structure of apo human ferroportin in lipid nanodisc
8BZY 3.24 Å, Structure of SLC40/ferroportin in complex with vamifeport and synthetic nanobody Sy3 in…
8C02 4.09 Å, Structure of SLC40/ferroportin in complex with synthetic nanobody Sy3 in occluded…

Browse structure collections

About this viewer

MolViewer shows 8C03 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.