Structure of the GEF Kalirin DH2 Domain. Determined by X-ray diffraction at 1.86 Å resolution. Released 24 Jan 2024.
Explore 8C7D in 3D Show helices and sheets RCSB PDB PDBe
8C7D contains 16 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 7-36 | 30 | |
| α-helix | 37-43 | 7 | |
| α-helix | 44-49 | 6 | |
| α-helix | 53-55 | 3 | |
| α-helix | 58-63 | 6 | |
| α-helix | 66-72 | 7 | |
| α-helix | 73-77 | 5 | |
| α-helix | 78-86 | 9 | |
| α-helix | 90-97 | 8 | |
| α-helix | 99-102 | 4 | |
| α-helix | 103-110 | 8 | |
| α-helix | 112-121 | 10 | |
| α-helix | 123-132 | 10 | |
| α-helix | 139-143 | 5 | |
| α-helix | 145-166 | 22 | |
| α-helix | 172-195 | 24 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Kalirin | A | protein | 201 | Homo sapiens | O60229 (AlphaFold model) |
>8C7D_1 Kalirin (chains A) SMKNPEEEQKAKALRGRMFVLNELVQTEKDYVKDLGIVVEGFMKRIEEKGVPEDMRGKDK IVFGNIHQIYDWHKDFFLAELEKCIQEQDRLAQLFIKHERKLHIYVWYCQNKPRSEYIVA EYDAYFEEVKQEINQRLTLSDFLIKPIQRITKYQLLLKDFLRYSEKAGLECSDIEKAVEL MCLVPKRCNDMMNLGRLQGFE
Structure-based alignment and analysis of RHO selectivity of RHO-DBL GTPase exchange factors. Callens, M.C., Thompson, A.P., Gray, J.L. et al. To be published.
Other PDB entries of the same protein (UniProt O60229 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8C7D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.