8C8F: E. coli maltodextrin-binding protein

Crystal structure of the E. coli maltodextrin-binding protein. Determined by X-ray diffraction at 1.15 Å resolution. Released 22 Feb 2023.

Method: X-ray diffraction
Resolution: 1.15 Å
Organism: Escherichia coli BL21
Chains: 1
Atoms: 3,358
Mol. weight: 43.54 kDa
Released: 22 Feb 2023

Explore 8C8F in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8C8F contains 22 α-helices and 26 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 22 helices, 26 β-strands

Element	Residues	Length	Sheet
α-helix	3-4	2
β-strand	8-11	4	1
α-helix	18-32	15
β-strand	36-39	4	1
α-helix	44-52	9
β-strand	60-64	5	1
α-helix	65-73	9
β-strand	77	1	2
α-helix	78-80	3
α-helix	84-87	4
β-strand	90	1	3
α-helix	92-97	6
β-strand	99-100	2	4
β-strand	103-104	2	4
β-strand	107-112	6	1
β-strand	115-119	5	5
β-strand	129	1	6
α-helix	130-132	3
α-helix	133-141	9
β-strand	146	1	7
α-helix	155-164	10
β-strand	168	1	8
β-strand	171-173	3	9
β-strand	176-178	3	9
β-strand	183	1	8
α-helix	187-201	15
α-helix	211-219	9
β-strand	223	1	7
β-strand	225-228	4	5
α-helix	230-235	6
β-strand	243-246	4	5
α-helix	247-249	3
β-strand	250-251	2	6
β-strand	254-255	2	6
β-strand	259-260	2	10
β-strand	261-267	7	1
β-strand	268	1	2
α-helix	274-280	7
α-helix	281-285	5
α-helix	288-297	10
β-strand	302-303	2	1
β-strand	305	1	3
α-helix	306-312	7
α-helix	316-327	12
β-strand	329-330	2	10
α-helix	331-332	2
α-helix	337-353	17
α-helix	358-369	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Maltose/maltodextrin-binding periplasmic protein	A	protein	396	Escherichia coli BL21	P0AEX9 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8C8F_1 Maltose/maltodextrin-binding periplasmic protein (chains A)
MKIKTGARILALSALTTMMFSASALAKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIK
VTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTW
DAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEP
YFTWPLIAADGGYAFKYENGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAE
AAFNKGETAMTINGPWAWSNIDTSKVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKE
LAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIP
QMSAFWYAVRTAVINAASGRQTVDEALKDAQTRITK

Primary citation

Crystal structure of the E. coli maltodextrin-binding protein. Marquez Espinoza, A., Rodrigues, M.J., Olieric, V. et al. To be published.

Other PDB entries of the same protein (UniProt P0AEX9 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4EXK 1.28 Å, A chimera protein containing MBP fused to the C-terminal domain of the uncharacterized…
3Q27 1.3 Å, Cyrstal structure of human alpha-synuclein (32-57) fused to maltose binding protein (MBP)
7KD4 1.31 Å, Structure of the C-terminal domain of the Menangle virus phosphoprotein (residues 329…
5M13 1.37 Å, Synthetic nanobody in complex with MBP
5HZ7 1.43 Å, High-resolution crystal structure of the minor DNA-binding pilin ComP from Neisseria…
5H7Q 1.45 Å, Crystal structure of human MNDA PYD domain with MBP tag
6XDS 1.47 Å, Crystal structure of MBP-TREM2 Ig domain fusion with fragment,…
4IRL 1.47 Å, X-ray structure of the CARD domain of zebrafish GBP-NLRP1 like protein
8SVY 1.47 Å, MBP-Mcl1 in complex with ligand 10
3MP6 1.48 Å, Complex Structure of Sgf29 and dimethylated H3K4
9CLC 1.48 Å, Crystal structure of maltose binding protein (Apo), mutant Trp10 to 4-Cyanotryptophan
3O3U 1.5 Å, Crystal Structure of Human Receptor for Advanced Glycation Endproducts (RAGE)

Browse structure collections

About this viewer

MolViewer shows 8C8F directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.