8C9X: Human alpha7 nicotinic receptor

human alpha7 nicotinic receptor in complex with the C4 nanobody. Determined by electron microscopy at 2.3 Å resolution. Released 11 Oct 2023.

Method: Electron microscopy
Resolution: 2.3 Å
Organisms: Homo sapiens, Vicugna pacos huacaya
Chains: 10
Atoms: 13,485
Mol. weight: 303.72 kDa
Ligands: NAG
Released: 11 Oct 2023

Explore 8C9X in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8C9X contains 25 α-helices and 150 β-strands across 10 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains A, B, C, D and E: 4 helices, 18 β-strands

Element	Residues	Length	Sheet
α-helix	2-10	9
α-helix	27	1
β-strand	28-43	16	1
β-strand	48-60	13	1
β-strand	76-79	4	1
β-strand	81	1	2
β-strand	84	1	2
β-strand	89-91	3	3
β-strand	94	1	1
β-strand	102	1	1
α-helix	106	1
β-strand	107-110	4	1
β-strand	114-117	4	1
β-strand	120-126	7	1
α-helix	134-136	3
β-strand	138-147	10	3
β-strand	155-159	5	1
β-strand	163	1	1
β-strand	168	1	1
β-strand	173-177	5	3
β-strand	180-186	7	3
β-strand	193-205	13	3

Chains F, G, H, I and J: 1 helix, 12 β-strands

Element	Residues	Length	Sheet
β-strand	4-8	5	16
β-strand	11-12	2	17
β-strand	18-26	9	16
α-helix	30-32	3
β-strand	33-40	8	17
β-strand	46-52	7	17
β-strand	59-61	3	17
β-strand	66	1	16
β-strand	69-74	6	16
β-strand	79-85	7	16
β-strand	93-101	9	17
β-strand	110-113	4	17
β-strand	117-120	4	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Neuronal acetylcholine receptor subunit alpha-7	A, B, C, D, E	protein	388	Homo sapiens	P36544 (AlphaFold model)
Nanobody C4	F, G, H, I, J	protein	147	Vicugna pacos huacaya

Sequence of entity 1 (A, B, C, D, E), FASTA

>8C9X_1 Neuronal acetylcholine receptor subunit alpha-7 (chains A, B, C, D, E)
EFQRKLYKELVKNYNPLERPVANDSQPLTVYFSLSLLQIMDVDEKNQVLTTNIWLQMSWT
DHYLQWNVSEYPGVKTVRFPDGQIWKPDILLYNSADERFDATFHTNVLVNSSGHCQYLPP
GIFKSSCYIDVRWFPFDVQHCKLKFGSWSYGGWSLDLQMQEADISGYIPNGEWDLVGIPG
KRSERFYECCKEPYPDVTFTVTMRRRTLYYGLNLLIPCVLISALALLVFLLPADSGEKIS
LGITVLLSLTVFMLLVAEIMPATSDSVPLIAQYFASTMIIVGLSVVVTVIVLQYHHHDPD
GGKMPKWTRVILLNWCAWFLRMKRDGVAVCSEWKFAACVVDRLCLMAFSVFTIICTIGIL
MSAPNFVEAVSKDFASAGLTETSQVAPA

Sequence of entity 2 (F, G, H, I, J), FASTA

>8C9X_2 Nanobody C4 (chains F, G, H, I, J)
AQVQLVESGGGLVQAGGSLKLSCAASGFTFAHYAMVWFRQAPGKEREFVAGISWSGASTY
YASSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYVAAARFGVGVDDDYSYWGQGTQVT
VSSAAEQKLISEEDLNGAAHHHHHHGS

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	10

Primary citation

An original potentiating mechanism revealed by the cryo-EM structures of the human alpha 7 nicotinic receptor in complex with nanobodies. Prevost, M.S., Barilone, N., Dejean de la Batie, G. et al. Nat Commun (2023) 14:5964-5964. DOI 10.1038/s41467-023-41734-4 · PubMed

Other PDB entries of the same protein (UniProt P36544 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8P1H 1.95 Å, Crystal structure of the chimera of human 14-3-3 zeta and phosphorylated cytoplasmic…
5AFN 2.15 Å, alpha7-AChBP in complex with lobeline and fragment 5
9QTO 2.16 Å, Human alpha7 nicotinic receptor in complex with the E6 nanobody
8V8A 2.19 Å, Alpha7-nicotinic acetylcholine receptor time resolved bound to epibatidine and…
5AFJ 2.2 Å, alpha7-AChBP in complex with lobeline and fragment 1
9QTN 2.28 Å, Human alpha7 nicotinic receptor in complex with the F1 nanobody
8UT1 2.3 Å, Alpha7-nicotinic acetylcholine receptor bound to epibatidine
8UTB 2.3 Å, Alpha7-nicotinic acetylcholine receptor bound to epibatidine and NS-1738
8UZJ 2.3 Å, Alpha7-nicotinic acetylcholine receptor bound to epibatidine and ivermectin
8V88 2.3 Å, Alpha7-nicotinic acetylcholine receptor bound to epibatidine and GAT107
8V80 2.34 Å, Alpha7-nicotinic acetylcholine receptor bound to epibatidine and (-)-TQS
5AFK 2.38 Å, alpha7-AChBP in complex with lobeline and fragment 2

Browse structure collections

About this viewer

MolViewer shows 8C9X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.