The FK1 domain of FKBP51 in complex with (1S,5S,6R)-10-((S)-(3,5-dichlorophenyl)sulfonimidoyl)-3-(pyridin-2-ylmethyl)-5-vinyl-3,10-diazabicyclo[4.3.1]decan-2-one. Determined by X-ray diffraction at 0.99 Å resolution. Released 6 Sept 2023.
Explore 8CHN in 3D Show helices and sheets RCSB PDB PDBe
8CHN contains 5 α-helices and 9 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 4-11 | 8 | |
| β-strand | 13-14 | 2 | 1 |
| β-strand | 23-29 | 7 | 1 |
| β-strand | 42-51 | 10 | 1 |
| β-strand | 56-59 | 4 | 1 |
| α-helix | 61-63 | 3 | |
| β-strand | 67-70 | 4 | 1 |
| α-helix | 78-85 | 8 | |
| α-helix | 87-88 | 2 | |
| β-strand | 92-97 | 6 | 1 |
| α-helix | 99-101 | 3 | |
| β-strand | 108 | 1 | 2 |
| β-strand | 112 | 1 | 2 |
| β-strand | 118-128 | 11 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Peptidyl-prolyl cis-trans isomerase FKBP5 | A | protein | 128 | Homo sapiens | Q13451 (AlphaFold model) |
>8CHN_1 Peptidyl-prolyl cis-trans isomerase FKBP5 (chains A) GAPATVTEQGEDITSKKDRGVLKIVKRVGNGEETPMIGDKVYVHYKGKLSNGKKFDSSHD RNEPFVFSLGKGQVIKAWDIGVATMKKGEIAHLLIKPEYAYGSAGSLPKIPSNATLFFEI ELLDFKGE
| ID | Name | Formula | Copies |
|---|---|---|---|
| UUI | (1S,5S,6R)-10-[[3,5-bis(chloranyl)phenyl]sulfonimidoyl]-5-ethenyl-3-(pyridin-2-… | C22 H24 Cl2 N4 O2 S | 1 |
Deconstructing Protein Binding of Sulfonamides and Sulfonamide Analogues. Purder, P.L., Meyners, C., Sugiarto, W.O. et al. JACS Au (2023) 3:2478-2486. DOI 10.1021/jacsau.3c00241 · PubMed
Other PDB entries of the same protein (UniProt Q13451 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8CHN directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.