E. coli beta-ketoacyl-[acyl carrier protein] synthase III (FabH) with an acetylated cysteine and in complex with oxa(dethia)-Coenzyme A. Determined by X-ray diffraction at 1.3 Å resolution. Released 15 Jun 2022.
Explore 8D1U in 3D Show helices and sheets RCSB PDB PDBe
8D1U contains 18 α-helices and 16 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-11 | 10 | 1 |
| β-strand | 15-18 | 4 | 2 |
| α-helix | 19-23 | 5 | |
| α-helix | 30-37 | 8 | |
| β-strand | 41-44 | 4 | 2 |
| α-helix | 51-66 | 16 | |
| α-helix | 70-72 | 3 | |
| β-strand | 75-79 | 5 | 1 |
| α-helix | 90-98 | 9 | |
| β-strand | 105-108 | 4 | 1 |
| α-helix | 111-113 | 3 | |
| α-helix | 114-127 | 14 | |
| β-strand | 133-140 | 8 | 1 |
| α-helix | 142-145 | 4 | |
| α-helix | 151-154 | 4 | |
| β-strand | 157 | 1 | 3 |
| β-strand | 160-169 | 10 | 1 |
| β-strand | 174-181 | 8 | 4 |
| α-helix | 183-188 | 6 | |
| β-strand | 189-190 | 2 | 5 |
| α-helix | 192-194 | 3 | |
| β-strand | 206-207 | 2 | 5 |
| α-helix | 209-230 | 22 | |
| α-helix | 235-237 | 3 | |
| β-strand | 240-243 | 4 | 4 |
| α-helix | 248-257 | 10 | |
| α-helix | 262-264 | 3 | |
| β-strand | 265 | 1 | 4 |
| α-helix | 269-272 | 4 | |
| β-strand | 274 | 1 | 3 |
| α-helix | 276-278 | 3 | |
| α-helix | 279-289 | 11 | |
| β-strand | 298-305 | 8 | 4 |
| β-strand | 309-316 | 8 | 4 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| 3-oxoacyl-[acyl-carrier-protein] synthase 3 | A | protein | 320 | Escherichia coli | P0A6R0 (AlphaFold model) |
>8D1U_1 3-oxoacyl-[acyl-carrier-protein] synthase 3 (chains A) SGGMYTKIIGTGSYLPEQVRTNADLEKMVDTSDEWIVTRTGIRERHIAAPNETVSTMGFE AATRAIEMAGIEKDQIGLIVVATTSATHAFPSAACQIQSMLGIKGCPAFDVAAACAGFTY ALSVADQYVKSGAVKYALVVGSDVLARTCDPTDRGTIIIFGDGAGAAVLAASEEPGIIST HLHADGSYGELLTLPNADRVNPENSIHLTMAGNEVFKVAVTELAHIVDETLAANNLDRSQ LDWLVPHQANLRIISATAKKLGMSMDNVVVTLDRHGNTSAASVPCALDEAVRDGRIKPGQ LVLLEAFGGGFTWGSALVRF
| ID | Name | Formula | Copies |
|---|---|---|---|
| UT7 | oxa(dethia)-CoA | C21 H36 N7 O17 P3 | 1 |
Water and common crystallization additives (CL) are not listed.
Structures of chloramphenicol acetyltransferase III and Escherichia coli beta-ketoacylsynthase III co-crystallized with partially hydrolysed acetyl-oxa(dethia)CoA. Benjamin, A.B., Stunkard, L.M., Ling, J. et al. Acta Crystallogr F Struct Biol Commun (2023) 79:61-69. DOI 10.1107/S2053230X23001206 · PubMed
Other PDB entries of the same protein (UniProt P0A6R0 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8D1U directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.