8DNS: Glyceraldehyde-3-phosphate dehydrogenase

Human Brain Glyceraldehyde 3-phosphate dehydrogenase. Determined by electron microscopy at 3.22 Å resolution. Released 16 Nov 2022.

Method: Electron microscopy
Resolution: 3.22 Å
Organism: Homo sapiens
Chains: 4
Atoms: 10,092
Mol. weight: 144.4 kDa
Released: 16 Nov 2022

Explore 8DNS in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8DNS contains 48 α-helices and 80 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chains O, P, Q and R: 12 helices, 20 β-strands

Element	Residues	Length	Sheet
β-strand	5-9	5	1
α-helix	13-25	13
β-strand	29-34	6	1
α-helix	40-48	9
β-strand	49-50	2	2
β-strand	54-55	2	2
α-helix	56	1
β-strand	60-63	4	1
β-strand	66-69	4	1
β-strand	72-77	6	1
β-strand	94-97	4	1
α-helix	105-114	10
β-strand	118-121	4	1
β-strand	130	1	1
α-helix	137-139	3
β-strand	146-148	3	1
α-helix	152-167	16
β-strand	170-179	10	3
α-helix	180-181	2
α-helix	196-199	4
β-strand	207-209	3	3
α-helix	213-220	8
β-strand	228-234	7	3
β-strand	240-249	10	3
α-helix	255-267	13
β-strand	271	1	3
β-strand	274-277	4	3
α-helix	283-286	4
β-strand	293-296	4	3
β-strand	302	1	3
β-strand	307-315	9	3
α-helix	316-334	19

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Glyceraldehyde-3-phosphate dehydrogenase	O, P, Q, R	protein	335	Homo sapiens	P04406 (AlphaFold model)

Sequence of entity 1 (O, P, Q, R), FASTA

>8DNS_1 Glyceraldehyde-3-phosphate dehydrogenase (chains O, P, Q, R)
MGKVKVGVNGFGRIGRLVTRAAFNSGKVDIVAINDPFIDLNYMVYMFQYDSTHGKFHGTV
KAENGKLVINGNPITIFQERDPSKIKWGDAGAEYVVESTGVFTTMEKAGAHLQGGAKRVI
ISAPSADAPMFVMGVNHEKYDNSLKIISNASCTTNCLAPLAKVIHDNFGIVEGLMTTVHA
ITATQKTVDGPSGKLWRDGRGALQNIIPASTGAAKAVGKVIPELNGKLTGMAFRVPTANV
SVVDLTCRLEKPAKYDDIKKVVKQASEGPLKGILGYTEHQVVSSDFNSDTHSSTFDAGAG
IALNDHFVKLISWYDNEFGYSNRVVDLMAHMASKE

Primary citation

A cryo-electron microscopic approach to elucidate protein structures from human brain microsomes. Tringides, M.L., Zhang, Z., Morgan, C.E. et al. Life Sci Alliance (2023) 6. DOI 10.26508/lsa.202201724 · PubMed

Other PDB entries of the same protein (UniProt P04406 (AlphaFold model), which also has an AlphaFold model), best resolution first:

27FM 1.46 Å, Crystal structure of human glyceraldehyde-3-phosphate dehydrogenase bound to gold(I)
6YND 1.52 Å, GAPDH purified from the supernatant of HEK293F cells: crystal form 1 of 4.
1U8F 1.75 Å, Crystal Structure Of Human Placental Glyceraldehyde-3-Phosphate Dehydrogenase At 1.75…
9L3E 1.77 Å, Structure of GAPDH complexed with Leu-F
8P5F 1.82 Å, Human wild-type GAPDH,orthorhombic form
6M61 1.82 Å, Glyceraldehyde-3-phosphate dehydrogenase (GAPDH) with inhibitor heptelidic acid
6YNE 1.85 Å, GAPDH purified from the supernatant of HEK293F cells: crystal form 2 of 4.
9UNY 1.87 Å, Natural product inhibitor of glyceraldehyde-3-phosphate dehydrogenase(GAPDH)
8G17 1.98 Å, CryoEM structure of wild-type GAPDH
4WNC 1.99 Å, Crystal structure of human wild-type GAPDH at 1.99 angstroms resolution
8G15 2.07 Å, CryoEM structure of nuclear GAPDH under 24h Oxidative Stress
8G16 2.07 Å, CryoEM structure of cytoplasmic GAPDH under 24h Oxidative Stress

Browse structure collections

About this viewer

MolViewer shows 8DNS directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.