8DS6: PEAK3 pseudokinase homodimer

Structure of the PEAK3 pseudokinase homodimer. Determined by electron microscopy at 4.9 Å resolution. Released 28 Jun 2023.

Method: Electron microscopy
Resolution: 4.9 Å
Organism: Homo sapiens
Chains: 2
Atoms: 5,028
Mol. weight: 104.71 kDa
Released: 28 Jun 2023

Explore 8DS6 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8DS6 contains 41 α-helices and 25 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 21 helices, 12 β-strands

Element	Residues	Length	Sheet
α-helix	131-157	27
α-helix	161-165	5
α-helix	169	1
β-strand	170-173	4	1
β-strand	180-181	2	1
β-strand	185-194	10	1
β-strand	197-206	10	1
α-helix	207	1
α-helix	216-221	6
α-helix	225-226	2
β-strand	230	1	2
β-strand	233-237	5	1
β-strand	251-254	4	1
β-strand	260-261	2	2
α-helix	262-269	8
α-helix	274-298	25
β-strand	300-302	3	3
α-helix	307-309	3
β-strand	310-313	4	2
α-helix	314-315	2
α-helix	323-324	2
β-strand	325-328	4	2
α-helix	331-333	3
β-strand	334-336	3	3
α-helix	344-346	3
α-helix	349-360	12
α-helix	364-365	2
α-helix	369-383	15
α-helix	388-399	12
α-helix	420-439	20
α-helix	443-446	4
α-helix	447-458	12
α-helix	461-472	12

Chain B: 20 helices, 13 β-strands

Element	Residues	Length	Sheet
α-helix	131-157	27
α-helix	162-165	4
β-strand	169-173	5	4
β-strand	180-182	3	4
β-strand	185-194	10	4
β-strand	197-206	10	4
α-helix	207	1
α-helix	215-223	9
α-helix	225-226	2
β-strand	230	1	5
β-strand	233-237	5	4
β-strand	251-254	4	4
β-strand	260-261	2	6
α-helix	262-269	8
α-helix	278-297	20
β-strand	300-302	3	7
α-helix	307-309	3
β-strand	311-313	3	6
α-helix	314-315	2
α-helix	323-324	2
β-strand	325-327	3	6
β-strand	328	1	5
α-helix	331-333	3
β-strand	334-336	3	7
α-helix	349-362	14
α-helix	365	1
α-helix	369-384	16
α-helix	388-399	12
α-helix	416-419	4
α-helix	420-440	21
α-helix	443-446	4
α-helix	447-458	12
α-helix	461-471	11

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Protein PEAK3	A, B	protein	491	Homo sapiens	Q6ZS72 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8DS6_1 Protein PEAK3 (chains A, B)
MSSPEPPTEPPEPDNPTWSTQPTYSNLGQIRAHLLPSKACRLRTPGSLSTNPEPLPPPLP
KKILTRTQSLPTRRTLHPSSIQVQPPRRPFLGSHSVDKSQAAVGPACLPAELTFGPADAP
LGLSLRDLHSPEAVHTALAARQLQGLRTIYARLRARLMGGHPGPCHPGHSFRLLDSSPCA
ESGDALYYRVVRAHEDAWHILVAKVPKPGADVPHPWGLELQASLSPHFNLQGLCGLVPEG
TLPGAPWRGAVALAAEVPERTVAQWLAEACTQPPEEFVWAVALLLLQLSAALKFLEAWGA
ALVELRPENLLLVAPRGCATTGPPRLLLTDFGRVCLQPPGPPGSPGPHAPQLGSLLRALL
SLAAPSTTPLAAGLELLAAQLTRLRPSASRTRGALQALLWGPGPELRGRGAPLGPWLRAL
GPWLRVRRGLLVLRLAERAAGGEAPSLEDWLCCEYLAEATESSMGQALALLWDLEGGGGA
DYKDDDDKGPV

Primary citation

Structural insights into regulation of the PEAK3 pseudokinase scaffold by 14-3-3. Torosyan, H., Paul, M.D., Forget, A. et al. Nat Commun (2023) 14:3543-3543. DOI 10.1038/s41467-023-38864-0 · PubMed

Other PDB entries of the same protein (UniProt Q6ZS72 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8DGO 2.3 Å, Growth Factor Receptor-Bound Protein 2 (Grb2) bound to phosphorylated PEAK3 (pY24) peptide
8DGP 2.7 Å, 14-3-3 epsilon bound to phosphorylated PEAK3 (pS69) peptide
8DP5 3.1 Å, Structure of the PEAK3/14-3-3 complex

Browse structure collections

About this viewer

MolViewer shows 8DS6 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.