8DTM: Insulin receptor

Cryo-EM structure of insulin receptor (IR) bound with S597 component 2. Determined by electron microscopy at 3.5 Å resolution. Released 7 Sept 2022.

Method: Electron microscopy
Resolution: 3.5 Å
Organisms: Mus musculus, synthetic construct
Chains: 3
Atoms: 6,498
Mol. weight: 308.75 kDa
Released: 7 Sept 2022

Explore 8DTM in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8DTM contains 22 α-helices and 70 β-strands across 3 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 9 helices, 45 β-strands

Element	Residues	Length	Sheet
β-strand	7-14	8	1
α-helix	19-23	5
β-strand	28-38	11	1
β-strand	56-57	2	1
β-strand	61-66	6	1
β-strand	71	1	2
β-strand	81-82	2	1
β-strand	93-96	4	1
β-strand	103	1	2
β-strand	111-112	2	1
β-strand	117-120	4	1
β-strand	144-146	3	1
β-strand	171	1	3
β-strand	180	1	3
β-strand	201	1	4
β-strand	207	1	4
β-strand	213	1	5
β-strand	215	1	5
β-strand	216	1	6
α-helix	222-224	3
β-strand	225	1	6
β-strand	231-233	3	7
β-strand	236-238	3	7
α-helix	241-242	2
β-strand	246-248	3	7
β-strand	252-254	3	7
α-helix	256-264	9
β-strand	278-279	2	8
β-strand	283	1	7
β-strand	284-285	2	8
β-strand	292-294	3	9
β-strand	300	1	8
β-strand	301-303	3	9
α-helix	308-309	2
β-strand	311-312	2	10
α-helix	315-317	3
β-strand	320-321	2	11
α-helix	324-328	5
β-strand	335-336	2	10
β-strand	340-342	3	11
α-helix	353-358	6
β-strand	363-364	2	10
β-strand	368-371	4	11
β-strand	378	1	12
β-strand	388	1	10
β-strand	394	1	11
β-strand	398-403	6	11
β-strand	410	1	12
β-strand	421	1	10
β-strand	425-429	5	11
β-strand	431	1	13
α-helix	436-446	11
β-strand	457	1	11
β-strand	462	1	13

Chain B: 11 helices, 25 β-strands

Element	Residues	Length	Sheet
β-strand	471-473	3	14
β-strand	475-480	6	15
β-strand	485-489	5	15
α-helix	497-499	3
β-strand	502-509	8	14
β-strand	532-534	3	14
α-helix	535-538	4
β-strand	552-555	4	15
α-helix	558-559	2
β-strand	563-571	9	14
β-strand	583-585	3	14
β-strand	588-591	4	14
α-helix	598-600	3
β-strand	601-606	6	16
β-strand	613-618	6	16
β-strand	629-637	9	17
α-helix	638-640	3
α-helix	643-645	3
α-helix	697-710	14
β-strand	761-765	5	17
β-strand	769-772	4	16
β-strand	780-788	9	17
β-strand	797	1	17
β-strand	801-806	6	17
α-helix	807-810	4
α-helix	815-817	3
β-strand	821-824	4	18
β-strand	829-833	5	18
β-strand	844-853	10	19
β-strand	859-864	6	19
α-helix	865-871	7
β-strand	874-877	4	18
β-strand	883-892	10	19
β-strand	896	1	19
α-helix	898-902	5
β-strand	903-906	4	19

Chain C: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	2-9	8
α-helix	10-14	5

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Insulin receptor	A, B	protein	1345	Mus musculus	P15208 (AlphaFold model)
Insulin mimetic peptide S597 component 2	C	protein	20	synthetic construct

Sequence of entity 1 (A, B), FASTA

>8DTM_1 Insulin receptor (chains A, B)
HLYPGEVCPGMDIRNNLTRLHELENCSVIEGHLQILLMFKTRPEDFRDLSFPKLIMITDY
LLLFRVYGLESLKDLFPNLTVIRGSRLFFNYALVIFEMVHLKELGLYNLMNITRGSVRIE
KNNELCYLATIDWSRILDSVEDNYIVLNKDDNEECGDVCPGTAKGKTNCPATVINGQFVE
RCWTHSHCQKVCPTICKSHGCTAEGLCCHKECLGNCSEPDDPTKCVACRNFYLDGQCVET
CPPPYYHFQDWRCVNFSFCQDLHFKCRNSRKPGCHQYVIHNNKCIPECPSGYTMNSSNLM
CTPCLGPCPKVCQILEGEKTIDSVTSAQELRGCTVINGSLIINIRGGNNLAAELEANLGL
IEEISGFLKIRRSYALVSLSFFRKLHLIRGETLEIGNYSFYALDNQNLRQLWDWSKHNLT
ITQGKLFFHYNPKLCLSEIHKMEEVSGTKGRQERNDIALKTNGDQASCENELLKFSFIRT
SFDKILLRWEPYWPPDFRDLLGFMLFYKEAPYQNVTEFDGQDACGSNSWTVVDIDPPQRS
NDPKSQTPSHPGWLMRGLKPWTQYAIFVKTLVTFSDERRTYGAKSDIIYVQTDATNPSVP
LDPISVSNSSSQIILKWKPPSDPNGNITHYLVYWERQAEDSELFELDYCLKGLKLPSRTW
SPPFESDDSQKHNQSEYDDSASECCSCPKTDSQILKELEESSFRKTFEDYLHNVVFVPRP
SRKRRSLEEVGNVTATTLTLPDFPNVSSTIVPTSQEEHRPFEKVVNKESLVISGLRHFTG
YRIELQACNQDSPDERCSVAAYVSARTMPEAKADDIVGPVTHEIFENNVVHLMWQEPKEP
NGLIVLYEVSYRRYGDEELHLCVSRKHFALERGCRLRGLSPGNYSVRVRATSLAGNGSWT
EPTYFYVTDYLDVPSNIAKIIIGPLIFVFLFSVVIGSIYLFLRKRQPDGPMGPLYASSNP
EYLSASDVFPSSVYVPDEWEVPREKITLLRELGQGSFGMVYEGNAKDIIKGEAETRVAVK
TVNESASLRERIEFLNEASVMKGFTCHHVVRLLGVVSKGQPTLVVMELMAHGDLKSHLRS
LRPDAENNPGRPPPTLQEMIQMTAEIADGMAYLNAKKFVHRDLAARNCMVAHDFTVKIGD
FGMTRDIYETDYYRKGGKGLLPVRWMSPESLKDGVFTASSDMWSFGVVLWEITSLAEQPY
QGLSNEQVLKFVMDGGYLDPPDNCPERLTDLMRMCWQFNPKMRPTFLEIVNLLKDDLHPS
FPEVSFFYSEENKAPESEELEMEFEDMENVPLDRSSHCQREEAGGREGGSSLSIKRTYDE
HIPYTHMNGGKKNGRVLTLPRSNPS

Sequence of entity 2 (C), FASTA

>8DTM_2 Insulin mimetic peptide S597 component 2 (chains C)
SLEEEWAQIECEVYGRGCPS

Primary citation

Activation of the insulin receptor by an insulin mimetic peptide. Park, J., Li, J., Mayer, J.P. et al. Nat Commun (2022) 13:5594-5594. DOI 10.1038/s41467-022-33274-0 · PubMed

Other PDB entries of the same protein (UniProt P15208 (AlphaFold model), which also has an AlphaFold model), best resolution first:

1LK2 1.35 Å, 1.35A crystal structure of H-2Kb complexed with the GNYSFYAL peptide
7SL7 3.1 Å, Full-length insulin receptor bound with both site 1 binding deficient mutant insulin…
7SL1 3.4 Å, Full-length insulin receptor bound with site 1 binding deficient mutant insulin (A-V3E)
7SL3 3.4 Å, Full-length insulin receptor bound with site 2 binding deficient mutant insulin (A-L13R)…
7STH 3.5 Å, Full-length insulin receptor bound with unsaturated insulin WT (2 insulin bound)…
7SL2 3.6 Å, Full-length insulin receptor bound with site 2 binding deficient mutant insulin (A-L13R)…
7SL6 3.7 Å, Full-length insulin receptor bound with site 2 binding deficient mutant insulin (B-L17R)…
8EZ0 3.7 Å, Cryo-EM structure of 4 insulins bound full-length mouse IR mutant with physically…
7STK 4.0 Å, Full-length insulin receptor bound with unsaturated insulin WT (2 insulins bound)…
7STJ 4.4 Å, Full-length insulin receptor bound with unsaturated insulin WT (2 insulins bound)…
8EYX 4.5 Å, Cryo-EM structure of 4 insulins bound full-length mouse IR mutant with physically…
7STI 4.9 Å, Full-length insulin receptor bound with unsaturated insulin WT (1 insulin bound)…

Browse structure collections

About this viewer

MolViewer shows 8DTM directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.