8EHZ: STUB1 TPR domain

Name: PDB 8EHZ: Crystal structure of the STUB1 TPR domain in complex with H317, a Helicon Polypeptide
Published: 2023-10-25
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Crystal structure of the STUB1 TPR domain in complex with H317, a Helicon Polypeptide. Determined by X-ray diffraction at 2.06 Å resolution. Released 25 Oct 2023.

Method: X-ray diffraction
Resolution: 2.06 Å
Organisms: synthetic construct, Homo sapiens
Chains: 4
Atoms: 2,279
Mol. weight: 34.71 kDa
Ligands: WHL
Released: 25 Oct 2023

Explore 8EHZ in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8EHZ contains 16 α-helices and 0 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	26-38	13
α-helix	42-55	14
α-helix	60-72	13
α-helix	76-89	14
α-helix	94-106	13
α-helix	110-127	18
α-helix	134-146	13

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	26-38	13
α-helix	42-55	14
α-helix	60-72	13
α-helix	76-89	14
α-helix	94-106	13
α-helix	110-126	17
α-helix	134-147	14

Chains C and D: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	8-13	6

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
H317	C, D	protein	12	synthetic construct
E3 ubiquitin-protein ligase CHIP	A, B	protein	139	Homo sapiens	Q9UNE7 (AlphaFold model)

Sequence of entity 1 (C, D), FASTA

>8EHZ_1 H317 (chains C, D)
XCWEAWLLCETX

Sequence of entity 2 (A, B), FASTA

>8EHZ_2 E3 ubiquitin-protein ligase CHIP (chains A, B)
GAMGSEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQ
HEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDI
PSALRIAKKKRWNSIEERR

Ligands and cofactors

ID	Name	Formula	Copies
WHL	N,N'-(1,4-phenylene)diacetamide	C10 H12 N2 O2	2

Primary citation

Recognition and reprogramming of E3 ubiquitin ligase surfaces by alpha-helical peptides. Tokareva, O.S., Li, K., Travaline, T.L. et al. Nat Commun (2023) 14:6992-6992. DOI 10.1038/s41467-023-42395-z · PubMed

Other PDB entries of the same protein (UniProt Q9UNE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9QFY 1.06 Å, Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 9.
6NSV 1.3 Å, Crystal structure of the human CHIP TPR domain in complex with a 5mer acetylated…
9QFS 1.33 Å, Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 8.
9QEU 1.35 Å, Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 1
8GCK 1.37 Å, Crystal structure of the human CHIP-TPR domain in complex with a 6mer acetylated tau…
8EI0 1.47 Å, Crystal structure of the STUB1 TPR domain in complex with H318, a Helicon Polypeptide
6EFK 1.5 Å, Crystal structure of the human CHIP TPR domain in complex with a 5mer acetylated HSP70…
9QF1 1.51 Å, Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 2
8F16 1.56 Å, Structure of the STUB1 TPR domain in complex with H203, an all-D Helicon Polypeptide
9DYB 1.6 Å, CHIP-TPR in complex with the phosphorylated Hsp70 tail
8SUV 1.63 Å, CHIP-TPR in complex with the C-terminus of CHIC2
8F14 1.69 Å, Structure of the STUB1 TPR domain in complex with H201, an all-D Helicon Polypeptide

Browse structure collections

About this viewer

MolViewer shows 8EHZ directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.