CHIP-TPR in complex with the phosphorylated Hsp70 tail. Determined by X-ray diffraction at 1.6 Å resolution. Released 26 Mar 2025.
Explore 9DYB in 3D Show helices and sheets RCSB PDB PDBe
9DYB contains 7 α-helices and 2 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 26-38 | 13 | |
| α-helix | 42-55 | 14 | |
| α-helix | 60-72 | 13 | |
| α-helix | 76-89 | 14 | |
| α-helix | 94-106 | 13 | |
| α-helix | 110-126 | 17 | |
| β-strand | 131 | 1 | 1 |
| β-strand | 133 | 1 | 1 |
| α-helix | 134-151 | 18 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase CHIP | A | protein | 139 | Homo sapiens | Q9UNE7 (AlphaFold model) |
| Heat shock 70 kDa protein 1A | B | protein | 8 | Homo sapiens |
>9DYB_1 E3 ubiquitin-protein ligase CHIP (chains A) GAMGSEKSPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQ HEQALADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDI PSALRIAKKKRWNSIEERR
>9DYB_2 Heat shock 70 kDa protein 1A (chains B) GPTIEEVD
Phosphorylation-State Modulated Binding of HSP70: Structural Insights and Compensatory Protein Engineering. Stewart, M., Paththamperuma, C., McCann, C. et al. bioRxiv (2025). DOI 10.1101/2025.02.17.637997 · PubMed
Other PDB entries of the same protein (UniProt Q9UNE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 9DYB directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.