8EI2: N-terminal domain of CUL5

Name: PDB 8EI2: Crystal structure of the N-terminal domain of CUL5 in complex with H314, a Helicon Polypeptide
Published: 2023-10-25
License: https://creativecommons.org/publicdomain/zero/1.0/
Keywords: ligase

Crystal structure of the N-terminal domain of CUL5 in complex with H314, a Helicon Polypeptide. Determined by X-ray diffraction at 2.8 Å resolution. Released 25 Oct 2023.

Method: X-ray diffraction
Resolution: 2.8 Å
Organisms: Homo sapiens, synthetic construct
Chains: 2
Atoms: 3,067
Mol. weight: 47.04 kDa
Ligands: WHL
Released: 25 Oct 2023

Explore 8EI2 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8EI2 contains 25 α-helices and 0 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 24 helices, 0 β-strands

Element	Residues	Length
α-helix	15-30	16
α-helix	37-53	17
α-helix	58-80	23
α-helix	88-103	16
α-helix	114-117	4
α-helix	134-143	10
α-helix	144-148	5
α-helix	149-166	18
α-helix	175-187	13
α-helix	198-202	5
α-helix	203-215	13
α-helix	218-224	7
α-helix	227-243	17
α-helix	245-248	4
α-helix	258-269	12
α-helix	271-273	3
α-helix	274-278	5
α-helix	281-286	6
α-helix	290-300	11
α-helix	308-324	17
α-helix	337-340	4
α-helix	343-359	17
α-helix	363-371	9
α-helix	374-376	3

Chain C: 1 helix, 0 β-strands

Element	Residues	Length	Sheet
α-helix	4-15	12

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Cullin-5	A	protein	387	Homo sapiens	Q93034 (AlphaFold model)
H314	C	protein	18	synthetic construct

Sequence of entity 1 (A), FASTA

>8EI2_1 Cullin-5 (chains A)
SMATSNLLKNKGSLQFEDKWDFMRPIVLKLLRQESVTKQQWFDLFSDVHAVCLWDDKGPA
KIHQALKEDILEFIKQAQARVLSHQDDTALLKAYIVEWRKFFTQCDILPKPFCQLEITLM
GKQGSNKKSNVEDSIVRKLMLDTWNESIFSNIKNRLQDSAMKLVHAERLGEAFDSQLVIG
VRESYVNLCSNPEDKLQIYRDNFEKAYLDSTERFYRTQAPSYLQQNGVQNYMKYADAKLK
EEEKRALRYLETRRECNSVEALMECCVNALVTSFKETILAECQGMIKRNETEKLHLMFSL
MDKVPNGIEPMLKDLEEHIISAGLADMVAAAETITTDSEKYREQLDTLFNRFSKLVKEAF
QDDPRFLTARDKAYKAVVNDATIFKLE

Sequence of entity 2 (C), FASTA

>8EI2_2 H314 (chains C)
XDPAWYDCADAAWICTFX

Ligands and cofactors

ID	Name	Formula	Copies
WHL	N,N'-(1,4-phenylene)diacetamide	C10 H12 N2 O2	1

Primary citation

Recognition and reprogramming of E3 ubiquitin ligase surfaces by alpha-helical peptides. Tokareva, O.S., Li, K., Travaline, T.L. et al. Nat Commun (2023) 14:6992-6992. DOI 10.1038/s41467-023-42395-z · PubMed

Other PDB entries of the same protein (UniProt Q93034 (AlphaFold model), which also has an AlphaFold model), best resolution first:

3DPL 2.6 Å, Structural Insights into NEDD8 Activation of Cullin-RING Ligases: Conformational Control…
9T7V 2.95 Å, Structure of LRRC58-EloB/C-CDO1 in complex with NEDD8-CUL5-RBX2-ARIH2-Ub
9SDX 2.97 Å, Structure of RBR binding E2 variant crosslinked with NEDD8-CUL5-RBX2 bound ARIH2 and Ub
3DQV 3.0 Å, Structural Insights into NEDD8 Activation of Cullin-RING Ligases: Conformational Control…
4JGH 3.0 Å, Structure of the SOCS2-Elongin BC complex bound to an N-terminal fragment of Cullin5
9SDY 3.06 Å, Structure of RBR E2 variant binding to CUL5-RBX2 bound ARIH2
8FVI 3.24 Å, Human APOBEC3H bound to HIV-1 Vif in complex with CBF-beta, ELOB, ELOC, and CUL5
4N9F 3.3 Å, Crystal structure of the Vif-CBFbeta-CUL5-ElOB-ElOC pentameric complex
7ONI 3.4 Å, Structure of Neddylated CUL5 C-terminal region-RBX2-ARIH2*
9EG1 3.52 Å, COP9 signalosome deneddylation complex with cullin-5
8FVJ 3.54 Å, Dimeric form of HIV-1 Vif in complex with human CBF-beta, ELOB, ELOC, and CUL5
9OMA 4.14 Å, Cryo-EM structure of PCMTD1-ELOBC-CUL5-RBX2 (CRL5-PCMTD1)

Browse structure collections

About this viewer

MolViewer shows 8EI2 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.