D30N mutant HIV protease in complex with benzoxaborolone analog of darunavir. Determined by X-ray diffraction at 1.35 Å resolution. Released 8 Feb 2023.
Explore 8ESY in 3D Show helices and sheets RCSB PDB PDBe
8ESY contains 2 α-helices and 18 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 2-3 | 2 | 1 |
| β-strand | 10-15 | 6 | 2 |
| β-strand | 20-24 | 5 | 2 |
| β-strand | 31-33 | 3 | 2 |
| β-strand | 42-49 | 8 | 2 |
| β-strand | 52-66 | 15 | 2 |
| β-strand | 69-77 | 9 | 2 |
| β-strand | 84-85 | 2 | 2 |
| α-helix | 87-90 | 4 | |
| β-strand | 96-98 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 102-103 | 2 | 1 |
| β-strand | 110-115 | 6 | 3 |
| β-strand | 118-124 | 7 | 3 |
| β-strand | 132-133 | 2 | 3 |
| β-strand | 143-149 | 7 | 3 |
| β-strand | 152-166 | 15 | 3 |
| β-strand | 169-177 | 9 | 3 |
| β-strand | 184-185 | 2 | 3 |
| α-helix | 187-192 | 6 | |
| β-strand | 196-198 | 3 | 1 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Protease | A, B | protein | 99 | Human immunodeficiency virus 1 | P04585 (AlphaFold model) |
>8ESY_1 Protease (chains A, B) PQITLWKRPLVTIKIGGQLKEALLDTGADNTVIEEMSLPGRWKPKMIGGIGGFIKVRQYD QIIIEIAGHKAIGTVLVGPTPVNIIGRNLLTQIGATLNF
| ID | Name | Formula | Copies |
|---|---|---|---|
| X7B | [(3~{a}~{S},4~{R},6~{a}~{R})-2,3,3~{a},4,5,6~{a}-hexahydrofuro[2,3-b]furan-4-yl… | C28 H36 B N2 O11 S | 1 |
Water and common crystallization additives (CL, GOL) are not listed.
Inhibition of HIV-1 Protease by a Boronic Acid with High Oxidative Stability. Graham, B.J., Windsor, I.W., Raines, R.T. ACS Med Chem Lett (2023) 14:171-175. DOI 10.1021/acsmedchemlett.2c00464 · PubMed
Other PDB entries of the same protein (UniProt P04585 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8ESY directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.