8F0E: Coatomer subunit beta'

N-terminal WD40 domain of beta'-COPI subunit with four chains in the asymmetric unit. Determined by X-ray diffraction at 1.31 Å resolution. Released 30 Aug 2023.

Method: X-ray diffraction
Resolution: 1.31 Å
Organism: Saccharomyces cerevisiae
Chains: 4
Atoms: 10,922
Mol. weight: 137.52 kDa
Released: 30 Aug 2023

Explore 8F0E in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8F0E contains 11 α-helices and 112 β-strands across 4 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 3 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	6-12	7	1
β-strand	16-21	6	2
β-strand	27-32	6	2
β-strand	36-41	6	2
β-strand	46-52	7	2
β-strand	58-64	7	3
α-helix	65-67	3
β-strand	69-74	6	3
β-strand	78-83	6	3
β-strand	89-94	6	3
β-strand	100-105	6	4
β-strand	111-116	6	4
β-strand	121-125	5	4
α-helix	126-128	3
β-strand	131-136	6	4
β-strand	143-149	7	5
β-strand	152-160	9	5
β-strand	164-169	6	5
β-strand	177-180	4	5
β-strand	189-192	4	6
β-strand	200-204	5	6
β-strand	209-214	6	6
β-strand	220-225	6	6
β-strand	231-236	6	7
β-strand	242-247	6	7
β-strand	252-256	5	7
β-strand	262-266	5	7
β-strand	273-278	6	1
α-helix	283-285	3
β-strand	286-291	6	1
β-strand	294-299	6	1

Chain B: 2 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	6-12	7	8
β-strand	16-21	6	9
β-strand	27-32	6	9
β-strand	36-41	6	9
β-strand	46-52	7	9
β-strand	58-64	7	10
α-helix	65-67	3
β-strand	69-74	6	10
β-strand	78-83	6	10
β-strand	89-94	6	10
β-strand	100-105	6	11
β-strand	111-116	6	11
β-strand	121-125	5	11
α-helix	126-128	3
β-strand	131-136	6	11
β-strand	143-148	6	12
β-strand	155-160	6	12
β-strand	164-169	6	12
β-strand	177-180	4	12
β-strand	187-192	6	13
β-strand	200-205	6	13
β-strand	209-214	6	13
β-strand	219-225	7	13
β-strand	231-236	6	14
β-strand	242-247	6	14
β-strand	252-256	5	14
β-strand	262-266	5	14
β-strand	273-278	6	8
β-strand	287-291	5	8
β-strand	294-299	6	8

Chain C: 3 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	6-12	7	15
β-strand	16-21	6	16
β-strand	27-32	6	16
β-strand	36-41	6	16
β-strand	46-52	7	16
β-strand	58-64	7	17
α-helix	65-67	3
β-strand	69-74	6	17
β-strand	78-83	6	17
β-strand	89-94	6	17
β-strand	100-105	6	18
β-strand	111-116	6	18
β-strand	121-125	5	18
α-helix	126-128	3
β-strand	131-136	6	18
β-strand	143-149	7	19
β-strand	152-160	9	19
β-strand	164-169	6	19
β-strand	177-180	4	19
β-strand	189-192	4	20
β-strand	200-204	5	20
β-strand	210-214	5	20
β-strand	220-224	5	20
β-strand	231-236	6	21
β-strand	242-247	6	21
β-strand	252-256	5	21
β-strand	262-266	5	21
β-strand	273-278	6	15
α-helix	283-285	3
β-strand	287-291	5	15
β-strand	294-299	6	15

Chain D: 3 helices, 28 β-strands

Element	Residues	Length	Sheet
β-strand	6-12	7	22
β-strand	16-21	6	23
β-strand	27-32	6	23
β-strand	36-41	6	23
β-strand	46-52	7	23
β-strand	58-64	7	24
α-helix	65-67	3
β-strand	69-74	6	24
β-strand	78-83	6	24
β-strand	89-94	6	24
β-strand	100-105	6	25
β-strand	111-116	6	25
β-strand	121-125	5	25
α-helix	126-128	3
β-strand	131-136	6	25
β-strand	143-148	6	26
β-strand	155-160	6	26
β-strand	164-169	6	26
β-strand	177-180	4	26
β-strand	187-192	6	27
β-strand	200-205	6	27
β-strand	209-214	6	27
β-strand	219-225	7	27
β-strand	231-236	6	28
β-strand	242-247	6	28
β-strand	252-256	5	28
β-strand	262-266	5	28
β-strand	273-278	6	22
α-helix	283-285	3
β-strand	287-291	5	22
β-strand	294-299	6	22

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Coatomer subunit beta'	A, B, C, D	protein	302	Saccharomyces cerevisiae	P41811 (AlphaFold model)

Sequence of entity 1 (A, B, C, D), FASTA

>8F0E_1 Coatomer subunit beta' (chains A, B, C, D)
SMKLDIKKTFSNRSDRVKGIDFHPTEPWVLTTLYSGRVEIWNYETQVEVRSIQVTETPVR
AGKFIARKNWIIVGSDDFRIRVFNYNTGEKVVDFEAHPDYIRSIAVHPTKPYVLSGSDDL
TVKLWNWENNWALEQTFEGHEHFVMCVAFNPKDPSTFASGCLDRTVKVWSLGQSTPNFTL
TTGQERGVNYVDYYPLPDKPYMITASDDLTIKIWDYQTKSCVATLEGHMSNVSFAVFHPT
LPIIISGSEDGTLKIWNSSTYKVEKTLNVGLERSWCIATHPTGRKNYIASGFDNGFTVLS
LG

Primary citation

Strategies for rapid production of crystallization quality coatomer WD40 domains. Dey, D., Hasan, S.S. Protein Expr Purif (2023) 212:106358-106358. DOI 10.1016/j.pep.2023.106358 · PubMed

Other PDB entries of the same protein (UniProt P41811 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8EWX 1.24 Å, N-terminal WD40 domain of beta'-COPI subunit with two chains in the asymmetric unit
8HQV 1.4 Å, The complex structure of COPI cargo sorting module with HCoV-OC43 Spike KTSHxx sorting…
8HQW 1.41 Å, The complex structure of COPI cargo sorting module with MHV Spike Hxx sorting motif
4J73 1.44 Å, Crystal structure of beta'-COP/p25 complex
8ENS 1.45 Å, Crystal structure of beta'-COPI-WD40 domain in complex with SARS-CoV-2 spike tail…
8ENW 1.45 Å, Crystal structure of beta'-COPI-WD40 domain in complex with SARS-CoV-2 clientized spike…
4J82 1.46 Å, Crystal structure of beta'-COP/Insig-2 complex
4J84 1.47 Å, Crystal structure of beta'-COP/Scyl1 complex
4J78 1.48 Å, Crystal structure of beta'-COP/Emp47p complex
4J86 1.48 Å, Crystal structure of beta'-COP/yWbp1 complex
8HQX 1.54 Å, The complex structure of COPI cargo sorting module with TAT-WDM peptide
4J79 1.56 Å, Crystal structure of beta'-COP/PEDVspike complex

Browse structure collections

About this viewer

MolViewer shows 8F0E directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.