Structure of the MDM2 P53 binding domain in complex with H102, an all-D Helicon Polypeptide. Determined by X-ray diffraction at 1.28 Å resolution. Released 15 Feb 2023.
Explore 8F10 in 3D Show helices and sheets RCSB PDB PDBe
8F10 contains 5 α-helices and 6 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 27-30 | 4 | 1 |
| α-helix | 32-40 | 9 | |
| β-strand | 48-49 | 2 | 1 |
| α-helix | 50-64 | 15 | |
| β-strand | 67 | 1 | 2 |
| β-strand | 74-76 | 3 | 2 |
| α-helix | 81-86 | 6 | |
| β-strand | 90-92 | 3 | 2 |
| α-helix | 96-105 | 10 | |
| β-strand | 107-109 | 3 | 1 |
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | 6-16 | 11 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| E3 ubiquitin-protein ligase Mdm2 | A | protein | 95 | Homo sapiens | Q00987 (AlphaFold model) |
| H102 | B | protein | 19 | synthetic construct |
>8F10_1 E3 ubiquitin-protein ligase Mdm2 (chains A) SQIPASEQETLVRPKPLLLKLLKSVGAQKDTYTMKEVLFYLGQYIMTKRLYDEKQQHIVY CSNDLLGDLFGVPSFSVKEHRKIYTMIYRNLVVVN
>8F10_2 H102 (chains B) XDPAWNHCEYAAFVCSEVX
| ID | Name | Formula | Copies |
|---|---|---|---|
| WHL | N,N'-(1,4-phenylene)diacetamide | C10 H12 N2 O2 | 1 |
Water and common crystallization additives (EDO, CL, GOL, IMD) are not listed.
Single-Shot Flow Synthesis of D-Proteins for Mirror-Image Phage Display. Callahan, A.J., Gandhesiri, S., Travaline, T.L. et al. ChemRxiv (2023). DOI 10.26434/chemrxiv-2023-x86xp
Other PDB entries of the same protein (UniProt Q00987 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8F10 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.