8F15: STUB1 TPR domain

Structure of the STUB1 TPR domain in complex with H202, an all-D Helicon Polypeptide. Determined by X-ray diffraction at 1.73 Å resolution. Released 15 Feb 2023.

Method: X-ray diffraction
Resolution: 1.73 Å
Organisms: Homo sapiens, synthetic construct
Chains: 6
Atoms: 4,113
Mol. weight: 52.75 kDa
Ligands: WHL
Released: 15 Feb 2023

Explore 8F15 in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8F15 contains 29 α-helices and 0 β-strands across 6 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	23-25	3
α-helix	26-38	13
α-helix	42-55	14
α-helix	60-72	13
α-helix	76-89	14
α-helix	94-106	13
α-helix	110-126	17
α-helix	134-152	19

Chain B: 7 helices, 0 β-strands

Element	Residues	Length
α-helix	26-38	13
α-helix	42-55	14
α-helix	60-72	13
α-helix	76-89	14
α-helix	94-106	13
α-helix	110-126	17
α-helix	134-151	18

Chain C: 8 helices, 0 β-strands

Element	Residues	Length
α-helix	23-25	3
α-helix	26-38	13
α-helix	42-55	14
α-helix	60-72	13
α-helix	76-89	14
α-helix	94-106	13
α-helix	110-127	18
α-helix	134-153	20

Chain D: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
α-helix	6-12	7

Chain E: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
α-helix	6-15	10

Chain F: 2 helices, 0 β-strands

Element	Residues	Length	Sheet
α-helix	3-5	3
α-helix	6-14	9

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
E3 ubiquitin-protein ligase CHIP	A, B, C	protein	134	Homo sapiens	Q9UNE7 (AlphaFold model)
all-D Helicon Polypeptide H202	D, E, F	protein	17	synthetic construct

Sequence of entity 1 (A, B, C), FASTA

>8F15_1 E3 ubiquitin-protein ligase CHIP (chains A, B, C)
GASPSAQELKEQGNRLFVGRKYPEAAACYGRAITRNPLVAVYYTNRALCYLKMQQHEQAL
ADCRRALELDGQSVKAHFFLGQCQLEMESYDEAIANLQRAYSLAKEQRLNFGDDIPSALR
IAKKKRWNSIEERR

Sequence of entity 2 (D, E, F), FASTA

>8F15_2 all-D Helicon Polypeptide H202 (chains D, E, F)
XPWWECLSQADDCDFRX

Ligands and cofactors

ID	Name	Formula	Copies
WHL	N,N'-(1,4-phenylene)diacetamide	C10 H12 N2 O2	3

Water and common crystallization additives (EDO) are not listed.

Primary citation

Single-Shot Flow Synthesis of D-Proteins for Mirror-Image Phage Display. Callahan, A.J., Gandhesiri, S., Travaline, T.L. et al. ChemRxiv (2023). DOI 10.26434/chemrxiv-2023-x86xp

Other PDB entries of the same protein (UniProt Q9UNE7 (AlphaFold model), which also has an AlphaFold model), best resolution first:

9QFY 1.06 Å, Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 9.
6NSV 1.3 Å, Crystal structure of the human CHIP TPR domain in complex with a 5mer acetylated…
9QFS 1.33 Å, Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 8.
9QEU 1.35 Å, Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 1
8GCK 1.37 Å, Crystal structure of the human CHIP-TPR domain in complex with a 6mer acetylated tau…
8EI0 1.47 Å, Crystal structure of the STUB1 TPR domain in complex with H318, a Helicon Polypeptide
6EFK 1.5 Å, Crystal structure of the human CHIP TPR domain in complex with a 5mer acetylated HSP70…
9QF1 1.51 Å, Structure of CHIP E3 ubiquitin ligase TPR domain in complex with compound 2
8F16 1.56 Å, Structure of the STUB1 TPR domain in complex with H203, an all-D Helicon Polypeptide
9DYB 1.6 Å, CHIP-TPR in complex with the phosphorylated Hsp70 tail
8SUV 1.63 Å, CHIP-TPR in complex with the C-terminus of CHIC2
8F14 1.69 Å, Structure of the STUB1 TPR domain in complex with H201, an all-D Helicon Polypeptide

Browse structure collections

About this viewer

MolViewer shows 8F15 directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.