8FSE: Integrin beta-2 tail

Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain. Determined by X-ray diffraction at 1.9 Å resolution. Released 3 Jul 2024.

Method: X-ray diffraction
Resolution: 1.9 Å
Organism: Mus musculus
Chains: 2
Atoms: 7,063
Mol. weight: 94.81 kDa
Released: 3 Jul 2024

Explore 8FSE in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8FSE contains 39 α-helices and 36 β-strands across 2 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 20 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	1
β-strand	13-19	7	1
β-strand	24	1	2
α-helix	25-35	11
α-helix	37-40	4
α-helix	44-46	3
β-strand	47-51	5	1
α-helix	56-58	3
β-strand	60-61	2	1
α-helix	62-63	2
β-strand	67	1	2
α-helix	68-71	4
β-strand	78-83	6	1
β-strand	85-91	7	3
β-strand	97-103	7	3
α-helix	108-118	11
α-helix	124-126	3
β-strand	127-130	4	3
α-helix	181-183	3
β-strand	191-195	5	3
α-helix	196-197	2
α-helix	209-224	16
α-helix	232-247	16
α-helix	262-264	3
α-helix	268-270	3
α-helix	274-285	12
α-helix	291-303	13
β-strand	311-317	7	4
α-helix	318-319	2
β-strand	326-332	7	4
β-strand	336-340	5	4
β-strand	347-352	6	4
α-helix	353-355	3
β-strand	358-361	4	4
β-strand	365-369	5	4
α-helix	371-373	3
β-strand	378-381	4	4
α-helix	385-403	19

Chain B: 19 helices, 18 β-strands

Element	Residues	Length	Sheet
β-strand	4-10	7	5
β-strand	13-19	7	5
β-strand	24	1	6
α-helix	25-35	11
α-helix	37-40	4
α-helix	44-46	3
β-strand	47-51	5	5
α-helix	56-58	3
β-strand	60-61	2	5
α-helix	62-63	2
β-strand	67	1	6
α-helix	68-71	4
β-strand	78-83	6	5
β-strand	85-91	7	7
β-strand	97-103	7	7
α-helix	108-118	11
α-helix	124-126	3
β-strand	127-130	4	7
α-helix	181-183	3
β-strand	191-195	5	7
α-helix	196-197	2
α-helix	209-224	16
α-helix	232-247	16
α-helix	262-264	3
α-helix	268-270	3
α-helix	274-284	11
α-helix	291-304	14
β-strand	311-317	7	8
β-strand	326-332	7	8
β-strand	336-340	5	8
β-strand	347-352	6	8
α-helix	353-355	3
β-strand	358-361	4	8
β-strand	365-369	5	8
α-helix	371-373	3
β-strand	378-381	4	8
α-helix	385-401	17

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Integrin beta-2,Talin-1	A, B	protein	411	Mus musculus	P11835 (AlphaFold model), P26039 (AlphaFold model)

Sequence of entity 1 (A, B), FASTA

>8FSE_1 Integrin beta-2,Talin-1 (chains A, B)
MNNDNPLFKSAMVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGL
FLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVT
DMLMTICARIGITNHDEYSLVRELMEEKKDELNWLDHGRTLREQGVEEHETLLLRRKFFY
SDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGF
LDLKDFLPKEYVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLKTYGVSFFLVKEKM
KGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYS
VQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKST

Primary citation

Molecular basis of beta 2 integrin activation by talin unveils subunit-specific mechanisms of integrin signaling. Gao, T., Maskalenko, N.A., Kabir, S. et al. Cell Rep (2025) 44:115607. DOI 10.1016/j.celrep.2025.115607

Other PDB entries of the same protein (UniProt P11835 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8FTB 1.97 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
8T0A 2.14 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…
8T0D 2.77 Å, Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain…

Browse structure collections

About this viewer

MolViewer shows 8FSE directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.