Crystal structure of integrin beta-2 tail bound to the FERM-folded talin head domain with E269A/Y270A/K306Q triple mutation. Determined by X-ray diffraction at 2.77 Å resolution. Released 3 Jul 2024.
Explore 8T0D in 3D Show helices and sheets RCSB PDB PDBe
8T0D contains 19 α-helices and 21 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| β-strand | 4-10 | 7 | 1 |
| β-strand | 13-19 | 7 | 1 |
| β-strand | 24 | 1 | 2 |
| α-helix | 25-35 | 11 | |
| α-helix | 37-40 | 4 | |
| α-helix | 44-46 | 3 | |
| β-strand | 47-51 | 5 | 1 |
| α-helix | 56-58 | 3 | |
| β-strand | 60-61 | 2 | 1 |
| α-helix | 62-63 | 2 | |
| β-strand | 67 | 1 | 2 |
| α-helix | 68-71 | 4 | |
| β-strand | 78-83 | 6 | 1 |
| β-strand | 85-91 | 7 | 3 |
| β-strand | 97-103 | 7 | 3 |
| β-strand | 107 | 1 | 4 |
| α-helix | 108-119 | 12 | |
| α-helix | 124-126 | 3 | |
| β-strand | 127-131 | 5 | 3 |
| β-strand | 173 | 1 | 3 |
| β-strand | 179 | 1 | 4 |
| α-helix | 181-183 | 3 | |
| β-strand | 190-195 | 6 | 3 |
| α-helix | 202-204 | 3 | |
| α-helix | 209-225 | 17 | |
| α-helix | 232-247 | 16 | |
| α-helix | 262-264 | 3 | |
| α-helix | 268-270 | 3 | |
| α-helix | 274-284 | 11 | |
| α-helix | 291-304 | 14 | |
| β-strand | 311-318 | 8 | 5 |
| β-strand | 325-332 | 8 | 5 |
| β-strand | 336-340 | 5 | 5 |
| β-strand | 347-352 | 6 | 5 |
| α-helix | 353-355 | 3 | |
| β-strand | 358-361 | 4 | 5 |
| β-strand | 365-369 | 5 | 5 |
| α-helix | 371-373 | 3 | |
| β-strand | 378-381 | 4 | 5 |
| α-helix | 385-404 | 20 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Integrin beta-2,Talin-1 | A | protein | 411 | Mus musculus | P11835 (AlphaFold model), P26039 (AlphaFold model) |
>8T0D_1 Integrin beta-2,Talin-1 (chains A) MNNDNPLFKSAMVALSLKISIGNVVKTMQFEPSTMVYDACRMIRERIPEALAGPPNDFGL FLSDDDPKKGIWLEAGKALDYYMLRNGDTMEYRKKQRPLKIRMLDGTVKTIMVDDSKTVT DMLMTICARIGITNHDEYSLVRELMEEKKDELNWLDHGRTLREQGVEEHETLLLRRKFFY SDQNVDSRDPVQLNLLYVQARDDILNGSHPVSFDKACEFAGFQCQIQFGPHNEQKHKAGF LDLKDFLPKAAVKQKGERKIFQAHKNCGQMSEIEAKVRYVKLARSLQTYGVSFFLVKEKM KGKNKLVPRLLGITKECVMRVDEKTKEVIQEWSLTNIKRWAASPKSFTLDFGDYQDGYYS VQTTEGEQIAQLIAGYIDIILKKKKSKDHFGLEGDEESTMLEDSVSPKKST
Molecular basis of beta 2 integrin activation by talin unveils subunit-specific mechanisms of integrin signaling. Gao, T., Maskalenko, N.A., Kabir, S. et al. Cell Rep (2025) 44:115607-115607. DOI 10.1016/j.celrep.2025.115607 · PubMed
Other PDB entries of the same protein (UniProt P11835 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8T0D directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.