8FXW: Cowpox virus M2

Cryo-EM structure of cowpox virus M2 in complex with human B7.1 (hexameric ring). Determined by electron microscopy at 2.7 Å resolution. Released 5 Feb 2025.

Method: Electron microscopy
Resolution: 2.7 Å
Organisms: Cowpox virus (Brighton Red), Homo sapiens
Chains: 12
Atoms: 15,144
Mol. weight: 296.8 kDa
Ligands: NAG
Released: 5 Feb 2025

Explore 8FXW in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8FXW contains 41 α-helices and 150 β-strands across 12 chains. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 4 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	1
α-helix	24-27	4
β-strand	33-44	12	2
β-strand	57-63	7	3
β-strand	66-73	8	3
β-strand	76-82	7	3
β-strand	89-97	9	2
β-strand	101-108	8	2
α-helix	116-118	3
β-strand	119-125	7	3
β-strand	131	1	4
β-strand	133-140	8	3
β-strand	148-154	7	3
β-strand	158-165	8	2
β-strand	181-183	3	2
α-helix	188-190	3
β-strand	192-197	6	2
α-helix	209-211	3
β-strand	213-216	4	2
β-strand	218-219	2	3

Chain B: 4 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	4
α-helix	24-27	4
β-strand	33-44	12	6
β-strand	57-63	7	7
β-strand	66-73	8	7
β-strand	76-82	7	7
β-strand	89-97	9	6
β-strand	101-108	8	6
β-strand	119-125	7	7
β-strand	131	1	8
β-strand	133-140	8	7
β-strand	148-154	7	7
β-strand	158-165	8	6
β-strand	181-183	3	6
α-helix	188-190	3
β-strand	192-197	6	6
α-helix	209-211	3
β-strand	213-216	4	6
α-helix	217	1
β-strand	218-219	2	7

Chains C and E: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	6
β-strand	12-14	3	9
α-helix	24-27	4
β-strand	28-34	7	6
β-strand	37-43	7	6
β-strand	46-49	4	6
α-helix	51-53	3
β-strand	58-60	3	9
β-strand	66-69	4	9
α-helix	74-76	3
β-strand	78-86	9	6
β-strand	92-105	14	6

Chain D: 2 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	8
α-helix	24-27	4
β-strand	33-44	12	10
β-strand	57-63	7	11
β-strand	66-73	8	11
β-strand	76-82	7	11
β-strand	89-97	9	10
β-strand	101-108	8	10
β-strand	119-125	7	11
β-strand	131	1	12
β-strand	133-140	8	11
β-strand	148-154	7	11
β-strand	158-165	8	10
β-strand	181-183	3	10
β-strand	192-197	6	10
α-helix	209-211	3
β-strand	213-216	4	10
β-strand	218-219	2	11

Chains F and I: 5 helices, 16 β-strands

Element	Residues	Length	Sheet
β-strand	22	1	12
α-helix	24-27	4
β-strand	33-44	12	14
β-strand	57-63	7	15
β-strand	66-73	8	15
β-strand	76-82	7	15
β-strand	89-97	9	14
β-strand	101-108	8	14
α-helix	116-118	3
β-strand	119-125	7	15
β-strand	131	1	16
β-strand	133-140	8	15
β-strand	148-154	7	15
β-strand	158-165	8	14
β-strand	181-183	3	14
α-helix	188-190	3
β-strand	192-197	6	14
α-helix	209-211	3
β-strand	213-216	4	14
α-helix	217	1
β-strand	218-219	2	15

Chains G and L: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	14
β-strand	12-14	3	17
α-helix	22-27	6
β-strand	28-34	7	14
β-strand	37-43	7	14
β-strand	46-49	4	14
α-helix	51-53	3
β-strand	58-60	3	17
β-strand	66-69	4	17
α-helix	74-76	3
β-strand	78-86	9	14
β-strand	92-105	14	14

Chain H: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	2
β-strand	12-14	3	5
α-helix	24-27	4
β-strand	28-34	7	2
β-strand	37-43	7	2
β-strand	46-49	4	2
α-helix	51-53	3
β-strand	58-60	3	5
β-strand	66-69	4	5
α-helix	74-76	3
β-strand	78-88	11	2
β-strand	91-105	15	2

Chain J: 3 helices, 9 β-strands

Element	Residues	Length	Sheet
β-strand	3-7	5	18
β-strand	12-14	3	21
α-helix	23-27	5
β-strand	28-34	7	18
β-strand	37-43	7	18
β-strand	46-49	4	18
α-helix	51-53	3
β-strand	58-60	3	21
β-strand	66-69	4	21
α-helix	74-76	3
β-strand	78-88	11	18
β-strand	91-105	15	18

1 more chain groups are not listed. Open the entry in the viewer and use the sequence panel to see them.

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
CPXV040 protein	A, B, D, F, I, K	protein	225	Cowpox virus (Brighton Red)	Q8QN22 (AlphaFold model)
T-lymphocyte activation antigen CD80	C, E, G, H, J, L	protein	201	Homo sapiens	P33681 (AlphaFold model)

Sequence of entity 1 (A, B, D, F, I, K), FASTA

>8FXW_1 CPXV040 protein (chains A, B, D, F, I, K)
KPEAEYKNTICPPRQDYRYWYFAAELTIGVNYDINSTIMGECHMSESYIDRNANIVLTGY
GLEINMTIMDTDQRFVAAAEGVGKDNKLSVLLFTTQRLDKVHHNISVTITCMEMNCGTTK
YDSDLPESIHHKSSCDITINGSCVTCVNLETDPTKINPHYLHPKDKYLYRNSEYGMRGSY
GVTFMDELNQCFLDIKEVSYDICYREGSTGGSENLYFQGHHHHHH

Sequence of entity 2 (C, E, G, H, J, L), FASTA

>8FXW_2 T-lymphocyte activation antigen CD80 (chains C, E, G, H, J, L)
VIHVTKEVKEVATLSCGHNVSVEELAQTRIYWQKEKKMVLTMMSGDMNIWPEYKNRTIFD
ITNNLSIVILALRPSDEGTYECVVLKYEKDAFKREHLAEVTLSVKADFPTPSISDFEIPT
SNIRRIICSTSGGFPEPHLSWLENGEELNAINTTVSQDPETELYAVSSKLDFNMTTNHSF
MCLIKYGHLRVNQTFNWNTAK

Ligands and cofactors

ID	Name	Formula	Copies
NAG	2-acetamido-2-deoxy-beta-D-glucopyranose	C8 H15 N O6	18

Primary citation

Structure basis of poxvirus mediated sabotage of T-cell costimulation. Elliott, J.I., Adams, L.J., Jethva, P.N. et al. To be published.

Other PDB entries of the same protein (UniProt Q8QN22 (AlphaFold model), which also has an AlphaFold model), best resolution first:

8FXZ 2.86 Å, Cryo-EM structure of cowpox virus M2 in complex with human B7.1 (heptameric ring)
8FXX 3.26 Å, Cryo-EM structure of cowpox virus M2 in complex with human B7.2 (heptameric ring)
8FXY 3.34 Å, Cryo-EM structure of cowpox virus M2 in complex with human B7.2 (hexameric ring)

Browse structure collections

About this viewer

MolViewer shows 8FXW directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.