MBP-Mcl1 in complex with ligand 32. Determined by X-ray diffraction at 1.46 Å resolution. Released 17 May 2023.
Explore 8G3X in 3D Show helices and sheets RCSB PDB PDBe
8G3X contains 33 α-helices and 24 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.
| Element | Residues | Length | Sheet |
|---|---|---|---|
| α-helix | -194--193 | 2 | |
| β-strand | -189--186 | 4 | 1 |
| α-helix | -179--165 | 15 | |
| β-strand | -161--158 | 4 | 1 |
| α-helix | -153--144 | 10 | |
| β-strand | -137--133 | 5 | 1 |
| α-helix | -132--130 | 3 | |
| α-helix | -129--124 | 6 | |
| β-strand | -120 | 1 | 2 |
| α-helix | -119--117 | 3 | |
| α-helix | -113--110 | 4 | |
| β-strand | -107 | 1 | 3 |
| α-helix | -105--100 | 6 | |
| β-strand | -98--97 | 2 | 4 |
| β-strand | -94--93 | 2 | 4 |
| β-strand | -90--85 | 6 | 1 |
| β-strand | -82--78 | 5 | 5 |
| β-strand | -68 | 1 | 6 |
| α-helix | -64--56 | 9 | |
| β-strand | -51--49 | 3 | 5 |
| α-helix | -42--33 | 10 | |
| β-strand | -29--24 | 6 | 7 |
| β-strand | -21--14 | 8 | 7 |
| α-helix | -10-4 | 15 | |
| α-helix | 14-22 | 9 | |
| β-strand | 26-31 | 6 | 5 |
| α-helix | 33-35 | 3 | |
| α-helix | 36-42 | 7 | |
| β-strand | 46-49 | 4 | 5 |
| α-helix | 50-52 | 3 | |
| β-strand | 53 | 1 | 6 |
| β-strand | 54 | 1 | 8 |
| β-strand | 57 | 1 | 8 |
| α-helix | 61 | 1 | |
| β-strand | 62-63 | 2 | 9 |
| β-strand | 64-70 | 7 | 1 |
| β-strand | 71 | 1 | 2 |
| α-helix | 77-83 | 7 | |
| α-helix | 84-88 | 5 | |
| α-helix | 91-100 | 10 | |
| β-strand | 105-106 | 2 | 1 |
| β-strand | 108 | 1 | 3 |
| α-helix | 109-115 | 7 | |
| α-helix | 119-130 | 12 | |
| β-strand | 132-133 | 2 | 9 |
| α-helix | 134-135 | 2 | |
| α-helix | 140-156 | 17 | |
| α-helix | 161-191 | 31 | |
| α-helix | 203-223 | 21 | |
| α-helix | 225-235 | 11 | |
| α-helix | 240-244 | 5 | |
| α-helix | 246-250 | 5 | |
| α-helix | 251-255 | 5 | |
| α-helix | 261-280 | 20 | |
| α-helix | 284-286 | 3 | |
| α-helix | 287-308 | 22 | |
| α-helix | 311-318 | 8 |
| Molecule | Chains | Type | Length | Organism | UniProt |
|---|---|---|---|---|---|
| Maltodextrin-binding protein, Induced myeloid leukemia cell differentiation protein Mcl-1 chimera | A | protein | 518 | Serratia sp. FS14, Homo sapiens | Q07820 (AlphaFold model) |
>8G3X_1 Maltodextrin-binding protein, Induced myeloid leukemia cell differentiation protein Mcl-1 chimera (chains A) GKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDI IFWAHDRFGGYAQSGLLAEITPDKAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNK DLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYENGKYDIK DVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSK VNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPL GAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDE ALKDAQTGSELYRQSLEIISRYLREQATGAADTAPMGASGATSRKALETLRRVGDGVQRN HETAFQGMLRKLDIKNEDDVKSLSRVMIHVFSDGVTNWGRIVTLISFGAFVAKHLKTINQ ESCIEPLAESITDVLVRTKRDWLVKQRGWDGFVEFFHV
| ID | Name | Formula | Copies |
|---|---|---|---|
| YLF | N-[(1'S,3aS,5R,15S,17S,19Z,21R,21aR)-6'-chloro-20-fluoro-21-{[(5S,9aS)-hexahydr… | C46 H59 Cl F N7 O8 S | 1 |
Water and common crystallization additives (EDO) are not listed.
Discovery of an Oral, Beyond-Rule-of-Five Mcl-1 Protein-Protein Interaction Modulator with the Potential of Treating Hematological Malignancies. Romanov-Michailidis, F., Hsiao, C.C., Urner, L.M. et al. J Med Chem (2023) 66:6122-6148. DOI 10.1021/acs.jmedchem.2c01953 · PubMed
Other PDB entries of the same protein (UniProt Q07820 (AlphaFold model), which also has an AlphaFold model), best resolution first:
MolViewer shows 8G3X directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.