8G8S: Bipartite p52 NLS

bipartite p52 NLS in complex with Importin alpha 2. Determined by X-ray diffraction at 2.1 Å resolution. Released 21 Feb 2024.

Method: X-ray diffraction
Resolution: 2.1 Å
Organisms: Mus musculus, Homo sapiens
Chains: 2
Atoms: 3,653
Mol. weight: 59.5 kDa
Released: 21 Feb 2024

Explore 8G8S in 3D Show helices and sheets RCSB PDB PDBe

Secondary structure: helices and β-sheets

8G8S contains 32 α-helices and 0 β-strands across 1 chain. Residue ranges use author residue numbering, as in the PDB file, from PDBe. To see them in 3D, choose the Cartoon representation with Secondary structure coloring: helices, sheets and coils get different colors.

Chain A: 32 helices, 0 β-strands

Element	Residues	Length
α-helix	78-85	8
α-helix	90-105	16
α-helix	112-117	6
α-helix	121-127	7
α-helix	134-148	15
α-helix	152-160	9
α-helix	163-170	8
α-helix	176-190	15
α-helix	194-202	9
α-helix	206-212	7
α-helix	218-220	3
α-helix	223-237	15
α-helix	243-245	3
α-helix	246-260	15
α-helix	265-279	15
α-helix	283-290	8
α-helix	295-302	8
α-helix	307-320	14
α-helix	325-333	9
α-helix	336-339	4
α-helix	340-343	4
α-helix	349-362	14
α-helix	367-375	9
α-helix	379-387	9
α-helix	391-407	17
α-helix	410-418	9
α-helix	422-427	6
α-helix	428-430	3
α-helix	434-454	21
α-helix	457-466	10
α-helix	469-476	8
α-helix	482-494	13

Molecules and chains

Molecule	Chains	Type	Length	Organism	UniProt
Importin subunit alpha-1	A	protein	510	Mus musculus	P52293 (AlphaFold model)
Nuclear factor NF-kappa-B p100 subunit isoform X1	B	protein	35	Homo sapiens	Q00653 (AlphaFold model)

Sequence of entity 1 (A), FASTA

>8G8S_1 Importin subunit alpha-1 (chains A)
MHHHHHHSSGLVPRGSGMLETAAALFERNHMDSPDLGTDDDDLAMADIGSNQGTVNWSVE
DIVKGINSNNLESQLQATQAARKLLSREKQPPIDNIIRAGLIPKFVSFLGKTDCSPIQFE
SAWALTNIASGTSEQTKAVVDGGAIPAFISLLASPHAHISEQAVWALGNIAGDGSAFRDL
VIKHGAIDPLLALLAVPDLSTLACGYLRNLTWTLSNLCRNKNPAPPLDAVEQILPTLVRL
LHHNDPEVLADSCWAISYLTDGPNERIEMVVKKGVVPQLVKLLGATELPIVTPALRAIGN
IVTGTDEQTQKVIDAGALAVFPSLLTNPKTNIQKEATWTMSNITAGRQDQIQQVVNHGLV
PFLVGVLSKADFKTQKEAAWAITNYTSGGTVEQIVYLVHCGIIEPLMNLLSAKDTKIIQV
ILDAISNIFQAAEKLGETEKLSIMIEECGGLDKIEALQRHENESVYKASLNLIEKYFSVE
EEEDQNVVPETTSEGFAFQVQDGAPGTFNF

Sequence of entity 2 (B), FASTA

>8G8S_2 Nuclear factor NF-kappa-B p100 subunit isoform X1 (chains B)
LKRKRGGDVSDSKQFTYYPLVEDKEEVQRKRRKAL

Primary citation

p52 bipartite NLS in complex with Importin alpha 2. Tsimbslyuk, S., Stewart, M., Forwood, J.K. To be published.

Other PDB entries of the same protein (UniProt P52293 (AlphaFold model), which also has an AlphaFold model), best resolution first:

4UAF 1.7 Å, Importin alpha 1 delta IBB in complex with Influenza PB2 nuclear localization domain
5CTT 1.7 Å, Crystal structure of human SART3/TIP110 NLS-mouse importin alpha complex
6IUA 1.7 Å, Crystal structure of importin-alpha1 bound to the 53BP1 nuclear localization signal…
6K06 1.75 Å, Crystal structure of Importin-alpha and phosphomimetic GM130
8HE0 1.8 Å, Crystal structure of importin-alpha1 bound to the HIF-1alpha nuclear localization signal…
4YI0 1.81 Å, Structure of mouse importin a1 bound to Pom121NLS
7RG1 1.85 Å, Importin alpha2 in complex with MERS ORF4B H26A mutant
4MZ6 1.88 Å, Structure of importin-alpha: dUTPase S11E NLS mutant complex
3UL1 1.9 Å, Mouse importin alpha: nucleoplasmin cNLS peptide complex
5D5K 1.9 Å, Crystal Structure NLS from human PARP-2 complexed with Importin alpha delta IBB
5UMZ 1.9 Å, Structure of TNRC6A NLS in complex with importin-alpha
6IU7 1.9 Å, Crystal structure of importin-alpha1 bound to the 53BP1 nuclear localization signal…

Browse structure collections

About this viewer

MolViewer shows 8G8S directly in your browser with nothing to install. Switch between cartoon, ball-and-stick, spacefill and surface views, color by chain, secondary structure or B-factor, measure distances, angles and dihedrals, and share or embed the view.